BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10k07r (768 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2062| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_24641| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 7e-08 SB_18579| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 7e-08 SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 7e-08 SB_42994| Best HMM Match : NHL (HMM E-Value=8.4e-34) 54 1e-07 SB_53796| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_3960| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_4642| Best HMM Match : Kunitz_BPTI (HMM E-Value=6.2e-28) 52 7e-07 SB_22840| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 51 1e-06 SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_59417| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_12543| Best HMM Match : TSP_1 (HMM E-Value=1.4e-07) 48 1e-05 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 47 1e-05 SB_21308| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_10520| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_57031| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_13096| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_7335| Best HMM Match : TSP_1 (HMM E-Value=0) 42 4e-04 SB_8177| Best HMM Match : TSP_1 (HMM E-Value=6e-38) 42 4e-04 SB_20896| Best HMM Match : TSP_1 (HMM E-Value=4.8e-28) 42 7e-04 SB_22619| Best HMM Match : TSP_1 (HMM E-Value=8.5e-14) 41 0.001 SB_37823| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_32130| Best HMM Match : TSP_1 (HMM E-Value=0) 41 0.001 SB_19921| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_50139| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_54415| Best HMM Match : TSP_1 (HMM E-Value=6.8e-21) 40 0.002 SB_14947| Best HMM Match : TSP_1 (HMM E-Value=6.8e-21) 40 0.002 SB_5403| Best HMM Match : TSP_1 (HMM E-Value=0) 40 0.002 SB_44878| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_33483| Best HMM Match : TSP_1 (HMM E-Value=0) 40 0.003 SB_12085| Best HMM Match : TBP (HMM E-Value=3.5e-35) 40 0.003 SB_26369| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_26365| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_51179| Best HMM Match : VWA (HMM E-Value=3.2e-18) 39 0.004 SB_45040| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_16252| Best HMM Match : Astacin (HMM E-Value=2.8e-17) 39 0.004 SB_43069| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_45039| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_42957| Best HMM Match : TSP_1 (HMM E-Value=6.1e-13) 38 0.009 SB_47663| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_31852| Best HMM Match : TSP_1 (HMM E-Value=4.2e-14) 38 0.012 SB_25011| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_50954| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_42731| Best HMM Match : fn3 (HMM E-Value=1.7e-26) 37 0.016 SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) 37 0.016 SB_40851| Best HMM Match : TSP_1 (HMM E-Value=3.4e-09) 37 0.021 SB_57496| Best HMM Match : TSP_1 (HMM E-Value=3.2e-13) 36 0.027 SB_47942| Best HMM Match : TSP_1 (HMM E-Value=0) 36 0.027 SB_44951| Best HMM Match : TSP_1 (HMM E-Value=3.2e-13) 36 0.027 SB_56860| Best HMM Match : Cadherin (HMM E-Value=4.4e-16) 36 0.027 SB_53102| Best HMM Match : CUB (HMM E-Value=3.3e-40) 36 0.027 SB_48544| Best HMM Match : TSP_1 (HMM E-Value=3.1e-32) 36 0.036 SB_56512| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 36 0.048 SB_44750| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_26728| Best HMM Match : Disintegrin (HMM E-Value=1.9e-23) 36 0.048 SB_21309| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_12581| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_35310| Best HMM Match : Cadherin (HMM E-Value=5.9e-23) 36 0.048 SB_6680| Best HMM Match : Astacin (HMM E-Value=0) 36 0.048 SB_2401| Best HMM Match : TSP_1 (HMM E-Value=0) 35 0.063 SB_39468| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.063 SB_44732| Best HMM Match : TSP_1 (HMM E-Value=0) 35 0.083 SB_40039| Best HMM Match : F5_F8_type_C (HMM E-Value=6.2e-12) 35 0.083 SB_30856| Best HMM Match : TSP_1 (HMM E-Value=5.9e-09) 35 0.083 SB_26395| Best HMM Match : TSP_1 (HMM E-Value=3.5e-09) 35 0.083 SB_59081| Best HMM Match : TSP_1 (HMM E-Value=2.5) 34 0.11 SB_40747| Best HMM Match : TSP_1 (HMM E-Value=8.1e-23) 34 0.11 SB_31961| Best HMM Match : EGF (HMM E-Value=0) 34 0.11 SB_3772| Best HMM Match : EGF (HMM E-Value=6.3e-06) 34 0.11 SB_56815| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_48395| Best HMM Match : MAM (HMM E-Value=0) 34 0.11 SB_16621| Best HMM Match : TSP_1 (HMM E-Value=1.9e-11) 34 0.11 SB_53752| Best HMM Match : TSP_1 (HMM E-Value=8.5e-11) 34 0.15 SB_47927| Best HMM Match : TSP_1 (HMM E-Value=9.5e-34) 34 0.15 SB_17144| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_39250| Best HMM Match : TSP_1 (HMM E-Value=9.5e-34) 34 0.15 SB_24894| Best HMM Match : TSP_1 (HMM E-Value=1.8e-10) 33 0.19 SB_5182| Best HMM Match : TSP_1 (HMM E-Value=1.1e-11) 33 0.19 SB_48913| Best HMM Match : TSP_1 (HMM E-Value=1.8e-11) 33 0.19 SB_38159| Best HMM Match : Peptidase_M28 (HMM E-Value=4.7e-09) 33 0.25 SB_38612| Best HMM Match : TSP_1 (HMM E-Value=3.3e-11) 33 0.25 SB_32913| Best HMM Match : TSP_1 (HMM E-Value=1.4e-16) 33 0.34 SB_11852| Best HMM Match : fn3 (HMM E-Value=1.2e-24) 32 0.44 SB_36995| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.44 SB_14123| Best HMM Match : TSP_1 (HMM E-Value=1.2e-05) 32 0.59 SB_13625| Best HMM Match : Reprolysin (HMM E-Value=2.3e-15) 32 0.59 SB_2827| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.59 SB_41161| Best HMM Match : TSP_1 (HMM E-Value=6e-22) 32 0.59 SB_57867| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.77 SB_23583| Best HMM Match : TSP_1 (HMM E-Value=0.095) 31 0.77 SB_18253| Best HMM Match : ADAM_spacer1 (HMM E-Value=4e-05) 31 1.0 SB_39876| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_3851| Best HMM Match : TSP_1 (HMM E-Value=3.7e-24) 31 1.4 SB_43343| Best HMM Match : fn3 (HMM E-Value=3.4e-39) 31 1.4 SB_34822| Best HMM Match : EGF_CA (HMM E-Value=8.9e-09) 31 1.4 SB_47693| Best HMM Match : TSP_1 (HMM E-Value=2.3e-09) 30 1.8 SB_43620| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_25565| Best HMM Match : TSP_1 (HMM E-Value=0.0032) 30 1.8 SB_47335| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_45482| Best HMM Match : BTB (HMM E-Value=5.6e-11) 29 3.1 SB_37175| Best HMM Match : GvpH (HMM E-Value=2.5) 29 3.1 SB_32009| Best HMM Match : PKD (HMM E-Value=1.9e-19) 29 3.1 SB_9137| Best HMM Match : SCP (HMM E-Value=3.6e-18) 29 3.1 SB_4595| Best HMM Match : TSP_1 (HMM E-Value=2.5e-05) 29 3.1 SB_58665| Best HMM Match : TSP_1 (HMM E-Value=7.5e-10) 29 3.1 SB_57196| Best HMM Match : ADAM_spacer1 (HMM E-Value=3.1e-31) 29 4.1 SB_50961| Best HMM Match : Trypsin (HMM E-Value=0) 29 4.1 SB_38710| Best HMM Match : 7tm_1 (HMM E-Value=4.6e-09) 29 4.1 SB_12542| Best HMM Match : Collagen (HMM E-Value=1.3) 29 4.1 SB_7281| Best HMM Match : TSP_1 (HMM E-Value=0.027) 29 5.5 SB_5639| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_59407| Best HMM Match : Toxin_4 (HMM E-Value=4.4) 29 5.5 SB_19793| Best HMM Match : TSP_1 (HMM E-Value=0.0027) 29 5.5 SB_11766| Best HMM Match : Reprolysin (HMM E-Value=1.6e-08) 29 5.5 SB_31319| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 >SB_2062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1136 Score = 56.4 bits (130), Expect = 2e-08 Identities = 22/42 (52%), Positives = 27/42 (64%) Frame = -1 Query: 300 DCQVSQWSDWSKCSQPCGVGYQERVRTILAQPGPGGVPCPKL 175 DCQ++ WS W+ CS CGVG Q R R I+ P G+PCP L Sbjct: 953 DCQLTHWSKWTSCSVTCGVGEQIRGRDIIRVPEHDGIPCPNL 994 Score = 49.2 bits (112), Expect = 4e-06 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 297 CQVSQWSDWSKCSQPCGVGYQERVRTILAQPGPGGVPCPKLM 172 C+V+ WS WS C CGVG + R R I+ Q G+ CP L+ Sbjct: 1011 CEVTPWSAWSSCRGSCGVGRKVRTRRIIRQSSLSGMTCPSLV 1052 >SB_24641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1120 Score = 54.8 bits (126), Expect = 7e-08 Identities = 19/51 (37%), Positives = 29/51 (56%) Frame = -1 Query: 612 CMEEPTQGPCRGLYQRWAFVAMKGMCIPFNYGGCRGSQNNFLTQEDCMNTC 460 C++ GPCR ++RW + C F YGGC+G+ NNF ++ +C C Sbjct: 225 CLQPKLTGPCRAYFERWFYNQTSRKCKQFVYGGCQGNSNNFESKAECEKKC 275 >SB_18579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 262 Score = 54.8 bits (126), Expect = 7e-08 Identities = 23/43 (53%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Frame = -1 Query: 300 DCQVSQWSDWSKCSQPCG-VGYQERVRTILAQPGPGGVPCPKL 175 +C VS W +WS CS PCG G Q RT+ QP GG PCP L Sbjct: 37 NCAVSGWGEWSACSAPCGSTGTQFTTRTVTRQPACGGSPCPTL 79 Score = 34.7 bits (76), Expect = 0.083 Identities = 17/37 (45%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTILAQPGP--GGVPC 184 S W WS CS+ CG G Q R R + P P GG C Sbjct: 119 STWGSWSVCSKTCGTGTQTRDR-LCTNPSPAFGGRYC 154 >SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3261 Score = 54.8 bits (126), Expect = 7e-08 Identities = 19/52 (36%), Positives = 29/52 (55%) Frame = -1 Query: 612 CMEEPTQGPCRGLYQRWAFVAMKGMCIPFNYGGCRGSQNNFLTQEDCMNTCK 457 C+ G C RW + +G C PF Y GC G++NNF+ ++ C+ TC+ Sbjct: 3156 CLLRSRTGSCSRFTVRWFYDTNRGKCAPFVYTGCGGNENNFMNEQKCLETCR 3207 >SB_42994| Best HMM Match : NHL (HMM E-Value=8.4e-34) Length = 750 Score = 54.0 bits (124), Expect = 1e-07 Identities = 19/51 (37%), Positives = 28/51 (54%) Frame = -1 Query: 612 CMEEPTQGPCRGLYQRWAFVAMKGMCIPFNYGGCRGSQNNFLTQEDCMNTC 460 C+ E GPCRG + +W + C F YGGC G+ N F ++ +C+ C Sbjct: 502 CVLENATGPCRGAFPKWYYSTADNACHEFLYGGCGGNANKFDSKSECLEVC 552 >SB_53796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 53.6 bits (123), Expect = 2e-07 Identities = 21/52 (40%), Positives = 28/52 (53%) Frame = -1 Query: 615 ICMEEPTQGPCRGLYQRWAFVAMKGMCIPFNYGGCRGSQNNFLTQEDCMNTC 460 IC GPCR +W + + CI F YGGC G+ NNF T+ +C + C Sbjct: 24 ICKMPAAAGPCRAAMPQWYYNFKRHRCIRFIYGGCGGNPNNFDTKNECKSAC 75 >SB_3960| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 762 Score = 52.4 bits (120), Expect = 4e-07 Identities = 22/43 (51%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = -1 Query: 300 DCQVSQWSDWSKCSQPCGVGYQERVRTILAQPGP-GGVPCPKL 175 DC VS WS WS CS CGVG ++R R ++ +P GG CP L Sbjct: 512 DCVVSTWSRWSPCSHRCGVGMRKRSRRVIVRPSQRGGKECPPL 554 >SB_4642| Best HMM Match : Kunitz_BPTI (HMM E-Value=6.2e-28) Length = 65 Score = 51.6 bits (118), Expect = 7e-07 Identities = 20/56 (35%), Positives = 30/56 (53%) Frame = -1 Query: 621 KRICMEEPTQGPCRGLYQRWAFVAMKGMCIPFNYGGCRGSQNNFLTQEDCMNTCKI 454 + +C + GPC+ R+ F K C F YGGC G++N F T+ +C CK+ Sbjct: 9 RSVCGLKVDPGPCKAYMPRFYFEIEKKECQEFIYGGCGGNENRFFTKRECQRICKL 64 >SB_22840| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 4002 Score = 50.8 bits (116), Expect = 1e-06 Identities = 22/52 (42%), Positives = 27/52 (51%) Frame = -1 Query: 615 ICMEEPTQGPCRGLYQRWAFVAMKGMCIPFNYGGCRGSQNNFLTQEDCMNTC 460 IC + G CR L W + KG CI F YGGC G+ N F T++ C C Sbjct: 2053 ICNLPMSVGRCRALMWMWYYNKKKGRCIRFAYGGCGGNPNRFKTKKACERRC 2104 >SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2101 Score = 50.4 bits (115), Expect = 2e-06 Identities = 19/55 (34%), Positives = 28/55 (50%) Frame = -1 Query: 624 AKRICMEEPTQGPCRGLYQRWAFVAMKGMCIPFNYGGCRGSQNNFLTQEDCMNTC 460 A ++C GPC + RW + C F YGGC+G+ NNF ++ C+ C Sbjct: 622 ATQVCSLPKLTGPCMARFIRWHYDMRSSECKMFTYGGCQGNANNFESKAACLKKC 676 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/56 (33%), Positives = 25/56 (44%) Frame = -1 Query: 627 TAKRICMEEPTQGPCRGLYQRWAFVAMKGMCIPFNYGGCRGSQNNFLTQEDCMNTC 460 +AK IC G C G + + G+C F+Y GC G+ N F T C C Sbjct: 677 SAKEICDLPAEAGSCDGHMPLYFHNSTSGLCEKFHYSGCEGNANRFPTMRKCQRKC 732 Score = 37.1 bits (82), Expect = 0.016 Identities = 15/57 (26%), Positives = 27/57 (47%) Frame = -1 Query: 630 LTAKRICMEEPTQGPCRGLYQRWAFVAMKGMCIPFNYGGCRGSQNNFLTQEDCMNTC 460 + + +C++ G + + A K +C PF Y G G++NNF ++ C C Sbjct: 199 IVPRSVCLQPSLIGTGFAFKVHFFYNAAKRLCEPFVYSGMGGNKNNFKDKDACQRAC 255 >SB_59417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1822 Score = 48.0 bits (109), Expect = 8e-06 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 2/54 (3%) Frame = -1 Query: 612 CMEEPTQGPC--RGLYQRWAFVAMKGMCIPFNYGGCRGSQNNFLTQEDCMNTCK 457 C +P G C + RW F G+C PF Y GC G+ N F+T+ C C+ Sbjct: 211 CTNQPDYGTCGFKNFVVRWYFDKAAGICKPFVYSGCGGNTNRFVTKRKCEAFCQ 264 >SB_12543| Best HMM Match : TSP_1 (HMM E-Value=1.4e-07) Length = 379 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/43 (51%), Positives = 23/43 (53%) Frame = -1 Query: 309 SPGDCQVSQWSDWSKCSQPCGVGYQERVRTILAQPGPGGVPCP 181 SP +C VSQWS W CS CG G Q R R I GG CP Sbjct: 33 SPRNCDVSQWSSWGDCSSHCGGGTQIRTRRITTPASCGG-GCP 74 Score = 36.3 bits (80), Expect = 0.027 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = -1 Query: 306 PGDCQVSQWSDWSKCSQPCGVGYQERVRTILAQPGPGGVPCP 181 P DC WS WS C CG Q R + QP GG CP Sbjct: 90 PVDCAFG-WSQWSPCVG-CGKSTQSRFPIVYRQPSCGGRSCP 129 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/54 (35%), Positives = 24/54 (44%) Frame = -1 Query: 621 KRICMEEPTQGPCRGLYQRWAFVAMKGMCIPFNYGGCRGSQNNFLTQEDCMNTC 460 K +C G CR W + G C FNYGGC G+ N F ++ C C Sbjct: 2119 KNVCSLPLRPGRCRARMVMWFYNKRTGRCQTFNYGGCGGNGNRFRSRRQCQRRC 2172 >SB_21308| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2641 Score = 45.2 bits (102), Expect = 6e-05 Identities = 24/64 (37%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = -1 Query: 648 DCTIDMLTAKRICMEEPTQGP-CRGLYQRWAFVAMKGMCIPFNYGGCRGSQNNFLTQEDC 472 +C D T +C E Q P C +++F + G C Y GC G+ NNF T E+C Sbjct: 2362 NCQEDPATDS-VC-ERMWQSPKCTSHLPKFSFNSQTGQCQQLAYNGCLGNLNNFDTAEEC 2419 Query: 471 MNTC 460 NTC Sbjct: 2420 QNTC 2423 >SB_10520| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1280 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/43 (44%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = -1 Query: 306 PGDCQVSQWSDWSKCSQPCGVGYQERVRTILAQPGP--GGVPC 184 P D ++WS WS C++PCG GY+ R R+ P P GG C Sbjct: 404 PVDGDWTEWSTWSYCNKPCGNGYENRTRS-CTNPSPMHGGKEC 445 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = -1 Query: 306 PGDCQVSQWSDWSKCSQPCGVGYQERVRTI-LAQPGPGGVPCP 181 P D Q +W WS C++ C G Q R+RT P GG CP Sbjct: 137 PVDGQYGEWGAWSNCTELCSGGTQLRMRTCDNPAPAYGGADCP 179 >SB_57031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1495 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/43 (44%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = -1 Query: 306 PGDCQVSQWSDWSKCSQPCGVGYQERVRTILAQPGP--GGVPC 184 P D ++WS WS C++PCG GY+ R R + P P GG C Sbjct: 468 PVDGNWTEWSTWSYCNRPCGTGYENRSR-FCSNPPPMYGGKDC 509 Score = 41.5 bits (93), Expect = 7e-04 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = -1 Query: 306 PGDCQVSQWSDWSKCSQPCGVGYQERVRTILAQPGP-GGVPC 184 P D ++W+ WS C++ CG G Q R+RT P GG+ C Sbjct: 291 PVDGNFTEWTSWSTCTRTCGAGTQWRMRTCTKPPAAYGGLNC 332 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = -1 Query: 309 SPGDCQVSQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPC 184 SP D ++W+ W+ C++ CG G Q R+RT P GG+ C Sbjct: 410 SPLDGNFTEWTKWTTCTRTCGTGAQMRMRTCTNPAPANGGLNC 452 Score = 40.3 bits (90), Expect = 0.002 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = -1 Query: 297 CQVSQWSDWSKCSQPCGVGYQERVR 223 C + W +WS+CSQ CG G+Q R++ Sbjct: 243 CNATLWGNWSECSQTCGTGFQTRIQ 267 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = -1 Query: 306 PGDCQVSQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPC 184 P + ++W+ W+ C++ CG G Q R+RT P GG+ C Sbjct: 351 PVNGNFTEWTKWTTCTRTCGTGTQWRMRTCTNPAPANGGLNC 392 Score = 28.7 bits (61), Expect = 5.5 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTILAQPGP 199 S+WS W C+ CG G + R + P Sbjct: 38 SEWSRWGPCNATCGPGVKMRTMNFTSFASP 67 >SB_13096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1465 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/36 (52%), Positives = 22/36 (61%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTILAQPGPGGVPCP 181 S WS+WS CS+ C G R RT +QP GG PCP Sbjct: 739 STWSEWSSCSRSCNNGTMFRNRT-CSQPLYGGAPCP 773 Score = 41.5 bits (93), Expect = 7e-04 Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 4/56 (7%) Frame = -1 Query: 339 NGVGGPTLTGSPGDCQV----SQWSDWSKCSQPCGVGYQERVRTILAQPGPGGVPC 184 NG + T + C V S WS WS CS+ C +G Q R+R +P GG PC Sbjct: 828 NGTNAQSRTCAFAPCPVNGAWSSWSAWSDCSKTCSIGEQIRMRN-CTEPRFGGKPC 882 Score = 38.7 bits (86), Expect = 0.005 Identities = 18/39 (46%), Positives = 24/39 (61%) Frame = -1 Query: 306 PGDCQVSQWSDWSKCSQPCGVGYQERVRTILAQPGPGGV 190 P D + WSDWS+CS CG G + R RT + +P GG+ Sbjct: 488 PVDGEWMPWSDWSECSHTCGNGSKVRTRTCV-KPLYGGL 525 Score = 36.3 bits (80), Expect = 0.027 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTILAQ 208 + W+ W+ CS+PC G Q RVR L+Q Sbjct: 1021 TSWTQWAGCSKPCTSGIQRRVRYCLSQ 1047 Score = 33.9 bits (74), Expect = 0.15 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRT 220 S WS+W+ CS CG G Q R R+ Sbjct: 902 SSWSNWTSCSVSCGSGVQVRTRS 924 Score = 33.5 bits (73), Expect = 0.19 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = -1 Query: 309 SPGDCQV--SQWSDWSKCSQPCGVGYQERVRTILAQ 208 +P DC S WS+W+ CS C G Q R R L + Sbjct: 783 NPTDCPSYWSNWSNWTDCSVSCSSGQQVRYRECLKE 818 Score = 32.7 bits (71), Expect = 0.34 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -1 Query: 282 WSDWSKCSQPCGVGYQERVR 223 W+ WS CS CGVG + R+R Sbjct: 445 WTSWSDCSVSCGVGARYRIR 464 Score = 31.9 bits (69), Expect = 0.59 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -1 Query: 282 WSDWSKCSQPCGVGYQERVR 223 WS W+ CS CG G+Q R R Sbjct: 962 WSPWTPCSATCGTGHQMRWR 981 Score = 31.1 bits (67), Expect = 1.0 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = -1 Query: 282 WSDWSKCSQPCGVGYQERVRTILAQ-PGPGGVPC 184 W+ W++CS C +G Q R R P GG C Sbjct: 387 WTSWTRCSSTCFIGQQLRTRNCTNPIPHFGGEKC 420 Score = 31.1 bits (67), Expect = 1.0 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTIL 214 S WS+WS+C++ C G + R R L Sbjct: 566 SGWSNWSECTRSCSNGTRSRTRICL 590 Score = 29.5 bits (63), Expect = 3.1 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 12/59 (20%) Frame = -1 Query: 336 GVGGPTLTGSPGD---CQVSQWSDW---SKCSQPCGVGYQ------ERVRTILAQPGPG 196 G+ G +T P C+ +WS+W + CS CG G + E+ IL + G G Sbjct: 304 GLAGQPVTAVPDSRFVCEYGEWSEWGAWTSCSSSCGGGKRRSRRACEKTTEILVKGGAG 362 Score = 29.5 bits (63), Expect = 3.1 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTILAQPGP--GGVPC 184 S+W+ WS CS C G R R + P P GG C Sbjct: 623 SEWTTWSPCSVSCSNGTISRTRH-CSNPSPKYGGKNC 658 >SB_7335| Best HMM Match : TSP_1 (HMM E-Value=0) Length = 2681 Score = 42.3 bits (95), Expect = 4e-04 Identities = 20/46 (43%), Positives = 28/46 (60%), Gaps = 5/46 (10%) Frame = -1 Query: 297 CQVS----QWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPCPKL 175 CQV+ W DWS+CS+ CGVG ++R R +P GG+ C +L Sbjct: 954 CQVNGGYTDWDDWSECSKSCGVGKKKRRRYCTNPEPAYGGLGCERL 999 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = -1 Query: 300 DCQVSQWSDWSKCSQPCGVGYQERVRTILA-QPGPGGVPC 184 D + S W++W+KC+ CG G + R R+ A P GG PC Sbjct: 1485 DGEFSDWTEWTKCTSSCGKGVRSRSRSCTAPAPELGGKPC 1524 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/43 (44%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = -1 Query: 306 PGDCQVSQWSDWSKCSQPCGVGYQERVRTILAQPGP--GGVPC 184 P D + ++WS W+ CS CG+G + R R AQP P GG C Sbjct: 894 PIDGKFAEWSPWTPCSVSCGIGLKNRTR-YCAQPPPMFGGKTC 935 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/37 (48%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTI-LAQPGPGGVPCP 181 S WS WS CS+ CG G +RVR+ P GG CP Sbjct: 1752 SSWSLWSSCSRSCGNGVVKRVRSCNFPAPSYGGADCP 1788 Score = 39.1 bits (87), Expect = 0.004 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = -1 Query: 309 SPGDCQVSQWSDWSKCSQPCGVGYQERVR 223 +P D S WS+W+ CS+ CG G++ R+R Sbjct: 1445 TPVDGGYSDWSEWTGCSKTCGTGFRSRIR 1473 Score = 37.9 bits (84), Expect = 0.009 Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = -1 Query: 306 PGDCQVSQWSDWSKCSQPCGVGYQERVRTILA-QPGPGGVPCPK 178 P D + WS+WS C CG G Q+R R + P GG C K Sbjct: 284 PIDGAYNDWSEWSICDVTCGGGVQQRYRDCTSPSPSLGGRDCVK 327 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = -1 Query: 297 CQVSQWSDWSKCSQPCGVGYQERVRTILAQPGPGGVPC 184 C W+ WS C+ CG G+QER R + P G + C Sbjct: 842 CTCGAWAPWSTCTATCGGGFQERTRDCV-PPKHGKMTC 878 Score = 36.7 bits (81), Expect = 0.021 Identities = 19/45 (42%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = -1 Query: 306 PGDCQVSQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPCPKL 175 P + S WS W+ CS CGVG ER R P GG C +L Sbjct: 780 PVNGNYSNWSLWTPCSVTCGVGIMERNRFCTNPPPALGGRDCSEL 824 Score = 36.7 bits (81), Expect = 0.021 Identities = 17/38 (44%), Positives = 19/38 (50%), Gaps = 4/38 (10%) Frame = -1 Query: 321 TLTGSPGDCQV----SQWSDWSKCSQPCGVGYQERVRT 220 T+ GDC V S W+ W CS CG G Q R RT Sbjct: 1531 TMACDYGDCPVNGTWSPWTGWQSCSATCGDGVQSRTRT 1568 Score = 36.3 bits (80), Expect = 0.027 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = -1 Query: 282 WSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPC 184 W+ W++CS+ CG G + R RT P GG+ C Sbjct: 552 WTPWTECSKSCGPGIRTRERTCTNPPPSSGGLDC 585 Score = 35.9 bits (79), Expect = 0.036 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTILAQPGP--GGVPC 184 ++WS W++C +PCG G R R+ A P P GG C Sbjct: 1197 TEWSKWTECDRPCGTGMMTRWRS-CANPIPQHGGQLC 1232 Score = 35.5 bits (78), Expect = 0.048 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = -1 Query: 306 PGDCQVSQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPC 184 P D + WSDW CS CG G + R R P GG C Sbjct: 1134 PSDGKWGAWSDWGSCSASCGPGKRIRTRECNDPAPKSGGKMC 1175 Score = 35.5 bits (78), Expect = 0.048 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPC 184 ++WS WS CS+ CG G + R R P GG+ C Sbjct: 1941 TEWSAWSDCSKSCGEGERYRTRNCTNPPPAWGGLDC 1976 Score = 35.1 bits (77), Expect = 0.063 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTI-LAQPGPGGVPC 184 S W++WS C+Q CG G + R R P GG C Sbjct: 1256 SSWTEWSDCTQECGDGVRTRSRYCDNPSPAAGGSDC 1291 Score = 34.7 bits (76), Expect = 0.083 Identities = 18/40 (45%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTILAQPGP--GGVPCPKL 175 SQWS W+ CS+ C G R R I P P GG C L Sbjct: 376 SQWSPWTPCSRSCQAGVVSRHR-ICNSPAPSSGGKDCSNL 414 Score = 34.7 bits (76), Expect = 0.083 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVR 223 S+WSDW++C++ CG G Q R R Sbjct: 436 SRWSDWTECTRSCGGGVQFRSR 457 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -1 Query: 282 WSDWSKCSQPCGVGYQERVRTI-LAQPGPGGVPC 184 W+ WS C++ CG G + R RT +P GG C Sbjct: 1022 WTGWSSCTKTCGFGIETRWRTCSKPEPMHGGRDC 1055 Score = 33.5 bits (73), Expect = 0.19 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Frame = -1 Query: 306 PGDCQVSQWSDWSKCSQPCGVGYQERVRTILAQPGP--GGVPC 184 P + +++S+W+ CS CGVG + R R+ P P GG C Sbjct: 483 PVNGNYTEFSEWTPCSTTCGVGIKTRKRS-CTNPAPQFGGKSC 524 Score = 33.5 bits (73), Expect = 0.19 Identities = 17/40 (42%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTILAQPGP--GGVPCPKL 175 S WS+W+ CS CG G R R + P P GG C L Sbjct: 609 SAWSNWTSCSATCGEGTMTRSR-LCDNPEPLHGGKDCSML 647 Score = 33.5 bits (73), Expect = 0.19 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = -1 Query: 282 WSDWSKCSQPCGVGYQERVRTILAQPGP--GGVPCPKL 175 WS WS+C + CG G + R+R+ P P GG C L Sbjct: 729 WSSWSECDKTCGGGKRVRMRS-CTNPTPQFGGSDCSVL 765 Score = 32.7 bits (71), Expect = 0.34 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVR 223 S W++W+ CS CG G QER R Sbjct: 231 SLWTEWNTCSTSCGGGTQERRR 252 Score = 32.3 bits (70), Expect = 0.44 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPC 184 S WS + CS CG G + R R+ +P GG+ C Sbjct: 1079 SSWSSFGACSSSCGKGVKTRTRSCSNPEPEYGGLTC 1114 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = -1 Query: 300 DCQVSQWSDWSKCSQPCGVGYQERVRTILAQ-PGPGGVPC 184 D + WS WS CS CG G R R + P GG C Sbjct: 664 DGAYNPWSAWSTCSVSCGGGVMFRHRNCTSPLPMHGGKDC 703 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -1 Query: 288 SQWSDWSKCSQPCGV-GYQERVRTILAQPGPGGVPCP 181 S W+ W+ C + CG G +ER RT GG CP Sbjct: 1998 SDWTGWTTCDRTCGAGGKRERSRTC-----QGGSNCP 2029 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/32 (40%), Positives = 15/32 (46%), Gaps = 3/32 (9%) Frame = -1 Query: 285 QWSDWSKCSQPCGVGYQERVRTILAQ---PGP 199 +WS WS C + CG G R R PGP Sbjct: 2249 EWSTWSPCMKTCGTGVMMRQRDCFTGSNCPGP 2280 >SB_8177| Best HMM Match : TSP_1 (HMM E-Value=6e-38) Length = 950 Score = 42.3 bits (95), Expect = 4e-04 Identities = 23/64 (35%), Positives = 28/64 (43%), Gaps = 5/64 (7%) Frame = -1 Query: 360 SSIVPLSNGVGGPTLTGSPGDCQV----SQWSDWSKCSQPCGVGYQERVRTIL-AQPGPG 196 S+ VP ++G DC + S+WS WS C PCG R RT P P Sbjct: 51 SNPVPSADGTYCTGENAQQKDCMIDGGFSEWSQWSLCDNPCGGSVVNRTRTCTNPTPTPD 110 Query: 195 GVPC 184 G PC Sbjct: 111 GKPC 114 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -1 Query: 282 WSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPC 184 WS W+ C++ CG G Q+R R +P GG C Sbjct: 237 WSSWTSCTKTCGTGMQKRSRDCTNPRPIHGGQNC 270 Score = 33.9 bits (74), Expect = 0.15 Identities = 19/45 (42%), Positives = 22/45 (48%), Gaps = 4/45 (8%) Frame = -1 Query: 306 PGDCQVSQWSDWSKCSQPCGV-GYQERVRTILAQPGP---GGVPC 184 P D + S WS WS+C Q CG+ G RT P GG PC Sbjct: 133 PVDGRWSDWSAWSRCPQACGISGGANIQRTRQCNNPPAMNGGEPC 177 >SB_20896| Best HMM Match : TSP_1 (HMM E-Value=4.8e-28) Length = 588 Score = 41.5 bits (93), Expect = 7e-04 Identities = 20/46 (43%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = -1 Query: 309 SPGDCQVSQWSDWSKCSQPCGVGYQERVRTI-LAQPGPGGVPCPKL 175 SP D S WS+WS+CS+ CG G R+R +P GG C L Sbjct: 330 SPLDGHWSDWSEWSRCSRQCGGGVHRRIRDCNNPRPAYGGKYCEGL 375 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/42 (45%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = -1 Query: 306 PGDCQVSQWSDWSKCSQPCGVGYQERVRTI-LAQPGPGGVPC 184 P D QWSDWS CS+ C G+Q+R R P GG C Sbjct: 529 PIDGAWGQWSDWSVCSRTCDGGFQKRERKCDSPAPQHGGKQC 570 >SB_22619| Best HMM Match : TSP_1 (HMM E-Value=8.5e-14) Length = 506 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/44 (45%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = -1 Query: 306 PGDCQVSQWSDWSKCSQPCG-VGYQERVRT-ILAQPGPGGVPCP 181 P +C VS WS W C+ CG G Q R RT +++ PGG CP Sbjct: 90 PRNCAVSAWSSWGPCTHQCGNAGTQTRTRTKTVSEACPGG-RCP 132 Score = 28.3 bits (60), Expect = 7.2 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = -1 Query: 300 DCQVSQWSDWSKCSQPCGVGYQERVRTILAQPGPGGVPCP 181 +C VS W +S CS CG + + +P CP Sbjct: 286 NCVVSSWGAYSDCSHQCGNSGTRTLTRRVTEPQKCDGKCP 325 >SB_37823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 423 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -1 Query: 309 SPGDCQVSQWSDWSKCSQPCGV-GYQERVRTILAQPGPGG 193 +P +C+V W+ WS C+Q CG G Q R+RT GG Sbjct: 27 APQNCEVGSWTSWSHCNQACGQHGTQRRMRTKTKSESCGG 66 >SB_32130| Best HMM Match : TSP_1 (HMM E-Value=0) Length = 446 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/37 (51%), Positives = 25/37 (67%), Gaps = 2/37 (5%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTILAQPGP--GGVPC 184 S++S+W+KC++ CG G QER RT A P P GG C Sbjct: 357 SEFSEWTKCTKTCGGGKQERTRT-CANPSPSNGGKDC 392 Score = 35.1 bits (77), Expect = 0.063 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPC 184 S +S WS C++ CG G + R RT +P GG C Sbjct: 300 SDYSSWSSCTKSCGGGTRTRTRTCTNPKPSSGGKDC 335 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPC 184 S +S WS C++ CG G + R RT +P GG C Sbjct: 243 SDYSSWSLCTKSCGGGTRTRTRTCTNPKPSSGGKDC 278 >SB_19921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 609 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/40 (47%), Positives = 25/40 (62%), Gaps = 2/40 (5%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPC-PKL 175 ++WSDWS CS+ CG+G + R RT P G PC P+L Sbjct: 361 TKWSDWSVCSKTCGLGEKSRERTCTNPTPKGNGRPCNPRL 400 >SB_50139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2211 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/36 (47%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPC 184 S++S+W+KC++ CG G QER RT P GG C Sbjct: 442 SEFSEWTKCTKTCGGGKQERTRTCTNPSPSNGGKDC 477 Score = 35.1 bits (77), Expect = 0.063 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPC 184 S +S WS C++ CG G + R RT +P GG C Sbjct: 385 SDYSSWSSCTKSCGGGTRTRTRTCTNPKPSSGGKDC 420 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPC 184 S +S WS C++ CG G + R RT +P GG C Sbjct: 328 SDYSSWSLCTKSCGGGTRTRTRTCTNPKPSSGGKDC 363 >SB_54415| Best HMM Match : TSP_1 (HMM E-Value=6.8e-21) Length = 612 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/36 (47%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPC 184 S++S+W+KC++ CG G QER RT P GG C Sbjct: 104 SEFSEWTKCTKTCGGGKQERTRTCTNPSPSNGGKDC 139 >SB_14947| Best HMM Match : TSP_1 (HMM E-Value=6.8e-21) Length = 666 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/36 (47%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPC 184 S++S+W+KC++ CG G QER RT P GG C Sbjct: 89 SEFSEWTKCTKTCGGGKQERTRTCTNPSPSNGGKDC 124 >SB_5403| Best HMM Match : TSP_1 (HMM E-Value=0) Length = 684 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/36 (47%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPC 184 S++S+W+KC++ CG G QER RT P GG C Sbjct: 473 SEFSEWTKCTKTCGGGKQERTRTCTNPSPSNGGKDC 508 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPC 184 S +S WS C++ CG G + R RT +P GG C Sbjct: 359 SDYSSWSLCTKSCGGGTRTRTRTCTNPKPSSGGKDC 394 Score = 32.7 bits (71), Expect = 0.34 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPC 184 S +S WS C++ C G + R RT +P GG C Sbjct: 416 SDYSSWSSCTKSCSGGTRTRTRTCTNPKPSSGGKDC 451 >SB_44878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1338 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/63 (34%), Positives = 29/63 (46%), Gaps = 3/63 (4%) Frame = -1 Query: 657 DRDDCTIDMLTAKRI---CMEEPTQGPCRGLYQRWAFVAMKGMCIPFNYGGCRGSQNNFL 487 DR C KRI C GPC +R+ + A G C F +GGC + NNF Sbjct: 1216 DRTGCQTCQCAQKRIKSVCKLPKFAGPCMASIERFYYNAKIGKCQSFVFGGCLPNGNNFK 1275 Query: 486 TQE 478 T++ Sbjct: 1276 TRK 1278 >SB_33483| Best HMM Match : TSP_1 (HMM E-Value=0) Length = 372 Score = 39.5 bits (88), Expect = 0.003 Identities = 20/43 (46%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = -1 Query: 306 PGDCQVSQWSDWSKCSQPCGVGYQERVRTILAQPGP--GGVPC 184 P D SQWS+W+ C+ CG G Q R RT P P GG C Sbjct: 234 PVDGNYSQWSEWTSCTVTCGGGEQMRSRT-CTNPTPHFGGKDC 275 Score = 34.7 bits (76), Expect = 0.083 Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = -1 Query: 306 PGDCQVSQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPCPK 178 P D S +S WS C++ CG G Q R RT P GG C + Sbjct: 118 PVDGGYSPYSKWSDCTETCGGGTQIRTRTCTNPPPKHGGRDCSR 161 Score = 32.7 bits (71), Expect = 0.34 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = -1 Query: 306 PGDCQVSQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPCPKL 175 P D WS++ CS CG G Q + RT P GG C +L Sbjct: 59 PIDGGYCDWSEYMSCSVTCGGGVQYKTRTCTNPPPQHGGKNCSEL 103 Score = 31.5 bits (68), Expect = 0.77 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = -1 Query: 300 DCQVSQWSDWSKCSQPCGVGYQERVRTI-LAQPGPGGVPCPKL 175 D S+WS + KCS+ C G Q R R +P GG C L Sbjct: 2 DGAYSEWSKFDKCSKSCAGGVQMRSRECNNPEPQYGGKTCSYL 44 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = -1 Query: 306 PGDCQVSQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPC 184 P D + ++++S+CS+ CG G Q R+R+ +P GG C Sbjct: 177 PIDGGFTSYTNYSECSKTCGGGTQVRLRSCTNPEPQYGGKNC 218 >SB_12085| Best HMM Match : TBP (HMM E-Value=3.5e-35) Length = 440 Score = 39.5 bits (88), Expect = 0.003 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 2/47 (4%) Frame = -1 Query: 306 PGDCQVSQWSDWSKCSQPCGVGYQERVRTILAQPGP--GGVPCPKLM 172 P D +S+WS++ C + CG G Q+RVRT P P GG C M Sbjct: 86 PIDGGLSEWSEFGNCDKSCGRGVQKRVRT-CTNPSPLFGGKDCAGAM 131 Score = 38.7 bits (86), Expect = 0.005 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTILA-QPGPGGVPC 184 S WS+WS C++ CG G Q ++R + PGP G C Sbjct: 35 SAWSEWSVCTRTCGEGLQGKIRKCNSPTPGPFGKRC 70 >SB_26369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 365 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = -1 Query: 315 TGSPGDCQVSQWSDWSKCSQPCGVGYQERVRTILAQPGP--GGVPC 184 + +P D + WS WS CS CG+G R R P P GG C Sbjct: 170 SSAPVDGGFTSWSSWSNCSSKCGIGTHNRTRN-CTNPAPAFGGSNC 214 Score = 35.1 bits (77), Expect = 0.063 Identities = 23/59 (38%), Positives = 27/59 (45%), Gaps = 8/59 (13%) Frame = -1 Query: 327 GPTLTGSPGD--CQVS----QWSDWSKCSQPCGVGYQERVRTILAQPGP--GGVPCPKL 175 G T+ P D C V+ WS+WS C CG G Q R R + P P GG C L Sbjct: 216 GNTMETEPCDNLCSVNGGYTAWSNWSACPVTCGAGSQARTRN-CSNPVPKNGGKDCTSL 273 >SB_26365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = -1 Query: 315 TGSPGDCQVSQWSDWSKCSQPCGVGYQERVRTILAQPGP--GGVPC 184 + +P D + WS WS CS CG+G R R P P GG C Sbjct: 193 SSAPVDGGFTSWSSWSNCSSKCGIGTHNRTRN-CTNPAPAFGGSNC 237 Score = 35.1 bits (77), Expect = 0.063 Identities = 23/59 (38%), Positives = 27/59 (45%), Gaps = 8/59 (13%) Frame = -1 Query: 327 GPTLTGSPGD--CQVS----QWSDWSKCSQPCGVGYQERVRTILAQPGP--GGVPCPKL 175 G T+ P D C V+ WS+WS C CG G Q R R + P P GG C L Sbjct: 239 GNTMETEPCDNLCSVNGGYTAWSNWSACPVTCGAGSQARTRN-CSNPVPKNGGKDCTSL 296 >SB_51179| Best HMM Match : VWA (HMM E-Value=3.2e-18) Length = 465 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = -1 Query: 300 DCQVSQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPC 184 D + S W W+KCS+ CG G++ R RT P GG C Sbjct: 176 DGKWSPWGPWTKCSKSCGTGFKSRERTCTNPVPENGGKKC 215 >SB_45040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 428 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTILAQPGPG 196 SQWS WS+CS CG G + R R + P PG Sbjct: 36 SQWSGWSQCSDSCGQGVRGRTR-VCNNPAPG 65 Score = 37.9 bits (84), Expect = 0.009 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTI-LAQPGPGGVPC 184 S+WS+WS C++ CG G + R+R PG G PC Sbjct: 229 SEWSNWSVCTRSCGQGLRGRIRRCDKPIPGVMGKPC 264 Score = 33.5 bits (73), Expect = 0.19 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVR-TILAQPGPGGVPC 184 ++WS++SKC + CG G + R R I P GG C Sbjct: 93 TEWSEYSKCDKSCGGGVRTRSRYCINPTPRHGGKDC 128 >SB_16252| Best HMM Match : Astacin (HMM E-Value=2.8e-17) Length = 580 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/44 (45%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = -1 Query: 309 SPGDCQVSQWSDWSKCSQPCGVGYQERVRTILAQPGP--GGVPC 184 +P D +WS WS CSQ CG G Q R R + P P GG C Sbjct: 305 APVDGHWGRWSVWSACSQTCGDGTQTRTR-VCDDPAPKNGGSAC 347 >SB_43069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = -1 Query: 309 SPGDCQVSQWSDWSKCSQPCG-VGYQERVRTILAQPGPGG 193 +P +CQV QW WS+C+ CG G Q R R+ GG Sbjct: 33 NPQNCQVGQWVPWSRCNLACGDYGTQRRTRSKTRSEKCGG 72 >SB_45039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 235 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTILAQPGPG 196 SQWS WS+CS+ CG G + R R + P PG Sbjct: 36 SQWSGWSQCSESCGQGERGRTR-VCNNPVPG 65 Score = 32.7 bits (71), Expect = 0.34 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = -1 Query: 306 PGDCQVSQWSDWSKCSQPCGVGYQERVRTILAQPGP-GGVPC 184 P D ++WS++S+C + CG G + R R P GG C Sbjct: 87 PVDGGYTEWSEYSECDKSCGGGVRTRSRDCQNPPAQHGGKEC 128 >SB_42957| Best HMM Match : TSP_1 (HMM E-Value=6.1e-13) Length = 649 Score = 37.9 bits (84), Expect = 0.009 Identities = 19/43 (44%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = -1 Query: 306 PGDCQVSQWSDWSKCSQPCGVGYQERVRTILAQPGP--GGVPC 184 P + Q S W ++S C+ CG G Q RVRT P P GG C Sbjct: 387 PVEGQWSDWGEYSACTVTCGFGVQHRVRT-CTNPSPQFGGKDC 428 >SB_47663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1409 Score = 37.5 bits (83), Expect = 0.012 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = -1 Query: 306 PGDCQVSQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPCPKL 175 P D +S+WS W KC + C G Q R R+ +P GG C L Sbjct: 1263 PVDGGLSEWSSWDKCDKLCADGQQRRHRSCTNPKPRCGGKDCTAL 1307 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = -1 Query: 282 WSDWSKCSQPCGVGYQERVRTILA-QPGPGGVPC 184 WS+W+ CS+ C G + R R + P GG C Sbjct: 578 WSEWTNCSRGCDGGNRRRHRFCNSPYPAHGGKDC 611 >SB_31852| Best HMM Match : TSP_1 (HMM E-Value=4.2e-14) Length = 162 Score = 37.5 bits (83), Expect = 0.012 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = -1 Query: 282 WSDWSKCSQPCGVGYQERVRTI-LAQPGPGGVPCPKLM 172 WS+WS CS CG G Q +R +P GG+PC M Sbjct: 109 WSEWSTCSVTCGGGTQLHMRVCNNPKPENGGLPCAGAM 146 >SB_25011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1018 Score = 37.5 bits (83), Expect = 0.012 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = -1 Query: 282 WSDWSKCSQPCGVGYQERVRTI-LAQPGPGGVPCPKLM 172 WS+WS CS CG G Q +R +P GG+PC M Sbjct: 474 WSEWSTCSVTCGGGTQLHMRVCNNPKPENGGLPCAGAM 511 >SB_50954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 768 Score = 37.1 bits (82), Expect = 0.016 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTILAQPGP--GGVPC 184 S WS+W+ C++ CG G + R RT +P P GG C Sbjct: 362 SSWSNWTACNETCGGGVKSRNRT-CTRPSPRYGGADC 397 Score = 31.5 bits (68), Expect = 0.77 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTIL 214 S WS+W+ CS C G Q R R L Sbjct: 300 SNWSNWTTCSVTCSGGVQSRTRFCL 324 >SB_42731| Best HMM Match : fn3 (HMM E-Value=1.7e-26) Length = 671 Score = 37.1 bits (82), Expect = 0.016 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = -1 Query: 282 WSDWSKCSQPCGVGYQERVRTILAQP 205 W +WS CS CG G Q R RT +A P Sbjct: 252 WGEWSACSATCGDGTQSRDRTCIAPP 277 >SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) Length = 590 Score = 37.1 bits (82), Expect = 0.016 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTILAQPGP--GGVPC 184 S WS+W+ C++ CG G + R RT +P P GG C Sbjct: 213 SSWSNWTACNETCGGGVKSRNRT-CTRPSPRYGGADC 248 Score = 31.5 bits (68), Expect = 0.77 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTIL 214 S WS+W+ CS C G Q R R L Sbjct: 151 SNWSNWTTCSVTCSGGVQSRTRFCL 175 >SB_40851| Best HMM Match : TSP_1 (HMM E-Value=3.4e-09) Length = 925 Score = 36.7 bits (81), Expect = 0.021 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 300 DCQVSQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPCP 181 D S WS++S+CS+ C G + R RT P GG CP Sbjct: 634 DGNYSAWSEFSQCSKSCDGGIKTRTRTCTNPSPSGGGRECP 674 >SB_57496| Best HMM Match : TSP_1 (HMM E-Value=3.2e-13) Length = 609 Score = 36.3 bits (80), Expect = 0.027 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -1 Query: 333 VGGPTLTGSPGDCQVSQWSDWSKCSQPCG 247 VG ++ C+VS WS WS CSQ CG Sbjct: 157 VGMSRVSDDGNPCKVSDWSKWSVCSQSCG 185 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -1 Query: 312 GSPGDCQVSQWSDWSKCSQPCGVGYQERVRTI-LAQPG 202 GS G W+ ++KC++ CG G+++R R +PG Sbjct: 245 GSAGIEVYGPWTGFTKCTKTCGGGWRKRTRRCHTTEPG 282 >SB_47942| Best HMM Match : TSP_1 (HMM E-Value=0) Length = 2195 Score = 36.3 bits (80), Expect = 0.027 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = -1 Query: 306 PGDCQVSQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPC 184 P D +QWS++S+CS+ CG+G R R +P GG C Sbjct: 440 PVDGGYTQWSEYSQCSKTCGLGEAFRTRNCTNPKPQHGGKGC 481 Score = 34.7 bits (76), Expect = 0.083 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = -1 Query: 306 PGDCQVSQWSDWSKCSQPCGVGYQERVRTILAQPGP--GGVPCPKL 175 P D +QW+ +S+CS+ CG G R R + P P GG C L Sbjct: 498 PVDGGYTQWTKYSECSKSCGNGTTNRTR-MCTNPAPRHGGEDCEHL 542 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = -1 Query: 306 PGDCQVSQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPCPKLMS 169 P D ++ WS++S+C + CG+G + + R+ +P GG C L S Sbjct: 616 PIDGGLTPWSNYSQCDKSCGMGTKMKTRSCTNPKPQYGGKDCSHLGS 662 Score = 33.5 bits (73), Expect = 0.19 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = -1 Query: 306 PGDCQVSQWSDWSKCSQPCGVGYQERVRTI-LAQPGPGGVPCPK 178 P D Q S WS ++ C++ CG G Q R R P GG C + Sbjct: 734 PIDGQYSNWSKFTVCTKSCGTGVQTRTRECNNPVPQYGGSGCER 777 Score = 32.7 bits (71), Expect = 0.34 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = -1 Query: 306 PGDCQVSQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPC 184 P D + S+WS +S C + CG G + R RT +P GG C Sbjct: 675 PIDGKYSKWSHYSGCDKSCGNGTRIRTRTCTRPRPQFGGRNC 716 Score = 31.1 bits (67), Expect = 1.0 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = -1 Query: 306 PGDCQVSQWSDWSKCSQPCGVGYQERVRTILAQPGP--GGVPCPKL 175 P D ++WS ++ C+ CG G + RVR +P P GG C L Sbjct: 793 PIDGGYTEWSSYAPCTVTCGGGVRLRVRN-CTKPAPQYGGRNCSTL 837 Score = 28.3 bits (60), Expect = 7.2 Identities = 12/36 (33%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPC 184 ++W+++++C+ CG G + R RT +P GG C Sbjct: 330 TEWTNFTECTVSCGNGTKFRNRTCTNPEPRHGGRDC 365 Score = 27.9 bits (59), Expect = 9.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTILAQP 205 + WS+++ CS CG G + R+R P Sbjct: 387 TMWSNFTTCSVSCGNGTRTRIRNCTNPP 414 >SB_44951| Best HMM Match : TSP_1 (HMM E-Value=3.2e-13) Length = 366 Score = 36.3 bits (80), Expect = 0.027 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -1 Query: 333 VGGPTLTGSPGDCQVSQWSDWSKCSQPCG 247 VG ++ C+VS WS WS CSQ CG Sbjct: 157 VGMSRVSDDGNPCKVSDWSKWSVCSQSCG 185 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -1 Query: 312 GSPGDCQVSQWSDWSKCSQPCGVGYQERVRTI-LAQPG 202 GS G W+ ++KC++ CG G+++R R +PG Sbjct: 245 GSAGIEVYGPWTGFTKCTKTCGGGWRKRTRRCHTTEPG 282 >SB_56860| Best HMM Match : Cadherin (HMM E-Value=4.4e-16) Length = 748 Score = 36.3 bits (80), Expect = 0.027 Identities = 16/38 (42%), Positives = 19/38 (50%) Frame = -1 Query: 294 QVSQWSDWSKCSQPCGVGYQERVRTILAQPGPGGVPCP 181 + WS WS+CS C VG Q R R + GG CP Sbjct: 88 KTQNWSSWSQCSSICSVGSQTRSRIKIVYESWGGT-CP 124 >SB_53102| Best HMM Match : CUB (HMM E-Value=3.3e-40) Length = 644 Score = 36.3 bits (80), Expect = 0.027 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTILAQPGPGGVP 187 ++W+ WS CS+ CG G Q ++R + Q GP P Sbjct: 219 AEWASWSDCSRECGGGSQRQIRKCI-QNGPDKCP 251 Score = 31.9 bits (69), Expect = 0.59 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVR 223 S WS W CS CG G Q+R R Sbjct: 292 SAWSTWGACSASCGGGIQQRRR 313 >SB_48544| Best HMM Match : TSP_1 (HMM E-Value=3.1e-32) Length = 326 Score = 35.9 bits (79), Expect = 0.036 Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPC 184 ++W++WS CS+ CG G++ R R+ +P GG C Sbjct: 145 TEWTEWSACSKTCGAGHRLRRRSCSNPKPQYGGSEC 180 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -1 Query: 285 QWSDWSKCSQPCGVGYQERVRTI-LAQPGPGGVPC 184 +WS WS CS C +G + R R P GG PC Sbjct: 202 EWSSWSSCSVTCDLGTKTRTRKCDNPLPKYGGKPC 236 >SB_56512| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 1219 Score = 35.5 bits (78), Expect = 0.048 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPC 184 S WS W++CS CG G ++R R+ +P GG C Sbjct: 199 SAWSKWTECSVTCGGGTRQRERSCTNPEPSNGGRDC 234 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTILAQPGPGG 193 S W+ W+ C+ CG G + R R+ P P G Sbjct: 261 SAWTKWTACTVTCGGGTRVRERS-CTNPAPQG 291 >SB_44750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2190 Score = 35.5 bits (78), Expect = 0.048 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTILAQPGP--GGVPC 184 +QWS+++ CS+ CG G + R R+ P P GGV C Sbjct: 257 TQWSEYTPCSKTCGGGTRHRTRS-CTNPAPQYGGVNC 292 Score = 31.1 bits (67), Expect = 1.0 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = -1 Query: 306 PGDCQVSQWSDWSKCSQPCGVGYQERVRTILAQPGP--GGVPCPKLM 172 P D + W+++S CS CG G R R ++P P GG C + + Sbjct: 310 PVDGGYTSWTEFSPCSVTCGRGLSTRSRA-CSEPAPQYGGRNCSEFL 355 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTILAQPGP--GGVPC 184 ++WSD++ CS C G + R R + P P GG+ C Sbjct: 200 AEWSDFTSCSVTCAQGSRTR-RRLCTSPPPQHGGLNC 235 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = -1 Query: 306 PGDCQVSQWSDWSKCSQPCGVGYQERVRTI-LAQPGPGGVPCPKL 175 P D WS +++CS CG G Q R R+ P G+ C +L Sbjct: 370 PIDGFYGNWSAFTRCSLSCGGGTQSRNRSCDSPSPVGEGLNCTRL 414 >SB_26728| Best HMM Match : Disintegrin (HMM E-Value=1.9e-23) Length = 1531 Score = 35.5 bits (78), Expect = 0.048 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = -1 Query: 291 VSQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPCPKL 175 +S+WS W KC + C G Q R R+ +P GG C L Sbjct: 1283 LSEWSSWDKCDKLCADGQQRRHRSCTNPKPRCGGKDCTAL 1322 >SB_21309| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1286 Score = 35.5 bits (78), Expect = 0.048 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPC 184 S WS+W++C+ CG G Q R R +P GG C Sbjct: 13 SAWSNWTECTVTCGSGKQFRTRNCTNPRPAFGGADC 48 Score = 34.7 bits (76), Expect = 0.083 Identities = 17/39 (43%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = -1 Query: 282 WSDWSKCSQPCGVGYQERVRTILA-QPGPGGVPCPKLMS 169 WSDWS C CG Q R R + +P GG C L S Sbjct: 320 WSDWSPCPVTCGGAMQLRTRNCSSPKPLNGGADCSSLGS 358 Score = 33.1 bits (72), Expect = 0.25 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTI-LAQPGPGGVPC 184 S+WS W++CS CG G Q R R P GG C Sbjct: 380 SEWSAWTECSATCGGGTQMRNRKCNNPNPQNGGKNC 415 Score = 28.7 bits (61), Expect = 5.5 Identities = 12/42 (28%), Positives = 16/42 (38%) Frame = -1 Query: 585 CRGLYQRWAFVAMKGMCIPFNYGGCRGSQNNFLTQEDCMNTC 460 C R + C + GC G+ N F T + C TC Sbjct: 577 CASSEMRAYYDVTSRQCKQTEFWGCNGNHNLFSTVDSCSKTC 618 >SB_12581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 756 Score = 35.5 bits (78), Expect = 0.048 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPC 184 S +S WS C++ CG G Q R RT +P GG C Sbjct: 92 SAYSSWSSCTKSCGGGTQTRTRTCTNPKPSNGGRDC 127 >SB_35310| Best HMM Match : Cadherin (HMM E-Value=5.9e-23) Length = 1250 Score = 35.5 bits (78), Expect = 0.048 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -1 Query: 291 VSQWSDWSKCSQPCGVGYQERVRTILAQPGPGG 193 +++WS WS+CS C +G R RT GG Sbjct: 15 LTEWSPWSQCSTNCSIGVTSRTRTKTTVESNGG 47 >SB_6680| Best HMM Match : Astacin (HMM E-Value=0) Length = 637 Score = 35.5 bits (78), Expect = 0.048 Identities = 18/40 (45%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = -1 Query: 300 DCQVSQWSDWSKCSQPCGVGYQERVRTI-LAQPGPGGVPC 184 D + SQW+ WS CS+ CG G Q R R P GG C Sbjct: 448 DGKWSQWTTWSDCSRQCGGGLQVRERKCNNPAPANGGKFC 487 >SB_2401| Best HMM Match : TSP_1 (HMM E-Value=0) Length = 818 Score = 35.1 bits (77), Expect = 0.063 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPC 184 S +S WS CS+ CG G R RT +P GG C Sbjct: 447 SDFSKWSTCSKSCGGGIMSRTRTCTNPKPAHGGKEC 482 Score = 34.7 bits (76), Expect = 0.083 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPC 184 +++S+WSKC++ CG G R RT +P GG C Sbjct: 766 TEFSEWSKCTRVCGKGSSTRNRTCTNPEPAWGGKKC 801 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPC 184 S +S WS C++ CG G R RT +P GG C Sbjct: 504 SDFSKWSSCTKSCGGGIMSRTRTCTNPKPANGGQEC 539 >SB_39468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1778 Score = 35.1 bits (77), Expect = 0.063 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = -1 Query: 318 LTGSPGDCQVSQWSDWSKCSQPCGVGYQERVRTILAQPGPGG 193 L P + + WS W++C QPCG+G ++R RT P G Sbjct: 1418 LPDCPVNGNYTSWSAWTEC-QPCGLGVRKRGRTCTNPPPLNG 1458 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = -1 Query: 309 SPGDCQVSQWSDWSKCSQPCGV-GYQERVRTIL-AQPGPGGVPC 184 +P D +QW+ WS+CS+ CG Q R+R P GG C Sbjct: 553 APVDGGFTQWTKWSECSETCGSDSIQMRMRVCTNPPPSNGGKDC 596 >SB_44732| Best HMM Match : TSP_1 (HMM E-Value=0) Length = 675 Score = 34.7 bits (76), Expect = 0.083 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -1 Query: 303 GDCQVSQWSDWSKCSQPCGVGYQER 229 G+C + W KCS+ CGVG+Q R Sbjct: 409 GECPTWKSGPWEKCSKTCGVGFQAR 433 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -1 Query: 303 GDCQVSQWSDWSKCSQPCGVGYQERVRTILA 211 G C V + W KCS CG G RV T A Sbjct: 563 GACPVWRVGPWEKCSVTCGEGVVRRVVTCSA 593 Score = 29.1 bits (62), Expect = 4.1 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -1 Query: 300 DCQVSQWSDWSKCSQPCGVGYQER 229 DC +W +CS CGVG Q R Sbjct: 614 DCPSWLSQEWGECSVTCGVGLQSR 637 >SB_40039| Best HMM Match : F5_F8_type_C (HMM E-Value=6.2e-12) Length = 1093 Score = 34.7 bits (76), Expect = 0.083 Identities = 15/30 (50%), Positives = 17/30 (56%) Frame = -1 Query: 282 WSDWSKCSQPCGVGYQERVRTILAQPGPGG 193 W DW CS C G QER+R + P PGG Sbjct: 196 WGDWGVCSSTCN-GQQERMRVCI--PSPGG 222 >SB_30856| Best HMM Match : TSP_1 (HMM E-Value=5.9e-09) Length = 197 Score = 34.7 bits (76), Expect = 0.083 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPC 184 +++S+WSKC++ CG G R RT +P GG C Sbjct: 65 TEFSEWSKCTRVCGKGSSTRNRTCTNPEPAWGGKKC 100 >SB_26395| Best HMM Match : TSP_1 (HMM E-Value=3.5e-09) Length = 250 Score = 34.7 bits (76), Expect = 0.083 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPC 184 +++S+WSKC++ CG G R RT +P GG C Sbjct: 174 TEFSEWSKCTRVCGKGSSTRNRTCTNPEPAWGGKKC 209 >SB_59081| Best HMM Match : TSP_1 (HMM E-Value=2.5) Length = 122 Score = 34.3 bits (75), Expect = 0.11 Identities = 13/26 (50%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = -1 Query: 297 CQVSQWSDWSKCSQPCG-VGYQERVR 223 C V +WS W CS CG +G Q R R Sbjct: 96 CTVGEWSSWGNCSHECGSIGEQHRHR 121 >SB_40747| Best HMM Match : TSP_1 (HMM E-Value=8.1e-23) Length = 179 Score = 34.3 bits (75), Expect = 0.11 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRT 220 S+WS WS C++ C G Q R+RT Sbjct: 6 SEWSPWSSCTRTCDTGEQLRMRT 28 Score = 29.5 bits (63), Expect = 3.1 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -1 Query: 285 QWSDWSKCSQPCGVGYQERVR 223 +W+ WS CS CG G + R R Sbjct: 117 EWTSWSACSVTCGGGQRFRTR 137 >SB_31961| Best HMM Match : EGF (HMM E-Value=0) Length = 2813 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = -1 Query: 312 GSPGD-CQVSQWSDWSKCSQPCGVGYQERVR 223 G GD C+ WS WS CS C G Q R R Sbjct: 664 GGGGDWCRYWPWSAWSACSSKCSYGSQTRTR 694 >SB_3772| Best HMM Match : EGF (HMM E-Value=6.3e-06) Length = 519 Score = 34.3 bits (75), Expect = 0.11 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -1 Query: 285 QWSDWSKCSQPCGVGYQERV 226 +WS WS CSQ CG G + RV Sbjct: 434 EWSSWSPCSQSCGRGLRRRV 453 >SB_56815| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 363 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = -1 Query: 324 PTLTGSPGDCQVSQWSDWSKCSQPCGVGYQERVR 223 P +T + S+WS WS CS CG G Q R R Sbjct: 99 PMVTSVAVNPHWSEWSPWSNCSVSCGNGTQSRSR 132 >SB_48395| Best HMM Match : MAM (HMM E-Value=0) Length = 901 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = -1 Query: 309 SPGDCQVSQWSDWSKCSQPCGVGYQERVRTILAQPGP--GGVPC 184 +P D +W+ W CS+ CG G R R + P P GG C Sbjct: 189 APVDGHWGRWASWGSCSKTCGNGIHTRTR-LCDDPAPKNGGKAC 231 >SB_16621| Best HMM Match : TSP_1 (HMM E-Value=1.9e-11) Length = 84 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = -1 Query: 285 QWSDWSKCSQPCGVGYQERVRTILAQPGP--GGVPC 184 +W+ W KCS+ CG GY+ R R + P P GG C Sbjct: 9 RWAAWGKCSRTCGRGYRLRSR-VCDNPTPQYGGKLC 43 >SB_53752| Best HMM Match : TSP_1 (HMM E-Value=8.5e-11) Length = 635 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPC 184 S+W+ WS C++ CG G R R+ +P GG C Sbjct: 382 SEWTSWSDCTRVCGKGTSTRKRSCTNPKPAWGGSDC 417 >SB_47927| Best HMM Match : TSP_1 (HMM E-Value=9.5e-34) Length = 512 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = -1 Query: 282 WSDWSKCSQPCGVGYQERVRTILA-QPGPGGVPC 184 W+ WS CS+ CG R R + +P GG PC Sbjct: 218 WTSWSLCSKTCGGAVVTRTRECNSPEPSNGGKPC 251 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 3/41 (7%) Frame = -1 Query: 282 WSDWSKCSQP--CGVGYQERVRTILA-QPGPGGVPCPKLMS 169 W +WS+C++ C G Q R R + +P GG CP L S Sbjct: 335 WGEWSECTEHKYCNKGDQVRKRKCNSPKPKDGGDKCPGLNS 375 >SB_17144| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 33.9 bits (74), Expect = 0.15 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTIL-AQPGPGGVPCPKL 175 S W WS C CG G +ER R PG GG C L Sbjct: 43 SPWGAWSGCDADCGGGVRERTRFCTNPVPGWGGRHCEAL 81 >SB_39250| Best HMM Match : TSP_1 (HMM E-Value=9.5e-34) Length = 468 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = -1 Query: 282 WSDWSKCSQPCGVGYQERVRTILA-QPGPGGVPC 184 W+ WS CS+ CG R R + +P GG PC Sbjct: 174 WTSWSLCSKTCGGAVVTRTRECNSPEPSNGGKPC 207 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 3/41 (7%) Frame = -1 Query: 282 WSDWSKCSQP--CGVGYQERVRTILA-QPGPGGVPCPKLMS 169 W +WS+C++ C G Q R R + +P GG CP L S Sbjct: 291 WGEWSECTEHKYCNKGDQVRKRKCNSPKPKDGGDKCPGLNS 331 >SB_24894| Best HMM Match : TSP_1 (HMM E-Value=1.8e-10) Length = 171 Score = 33.5 bits (73), Expect = 0.19 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = -1 Query: 300 DCQVSQWSDWSKCSQPCGVGYQERVRTILAQPGPGGVPCPKL 175 +CQ S WS W C Q R R I+ GG PC L Sbjct: 68 NCQTSNWSHWGSCHYH---STQSRSRNIIKNAACGGSPCGAL 106 Score = 30.3 bits (65), Expect = 1.8 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRT 220 S W W CS+ CG G R RT Sbjct: 120 SSWGAWHACSKTCGKGVTYRTRT 142 >SB_5182| Best HMM Match : TSP_1 (HMM E-Value=1.1e-11) Length = 1417 Score = 33.5 bits (73), Expect = 0.19 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = -1 Query: 309 SPGDCQVSQWSDWSKCSQPCGVGYQERVRTILAQPGP--GGVPC 184 SP D +WS W++CS+ C G + R R + P P GG C Sbjct: 562 SPRDGSWGKWSQWTECSRFCNGGTRMRYR-LCDSPSPRYGGKEC 604 >SB_48913| Best HMM Match : TSP_1 (HMM E-Value=1.8e-11) Length = 1068 Score = 33.5 bits (73), Expect = 0.19 Identities = 17/37 (45%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = -1 Query: 288 SQWS-DWSKCSQPCGVGYQERVRTIL-AQPGPGGVPC 184 S WS D+S CS CG G Q + RT +P GG C Sbjct: 430 SNWSADYSTCSYTCGGGVQWKTRTCTNPKPSRGGADC 466 Score = 28.7 bits (61), Expect = 5.5 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 2/21 (9%) Frame = -1 Query: 285 QWS--DWSKCSQPCGVGYQER 229 QW WS CS CG G QER Sbjct: 690 QWKIGSWSACSNACGPGSQER 710 >SB_38159| Best HMM Match : Peptidase_M28 (HMM E-Value=4.7e-09) Length = 1049 Score = 33.1 bits (72), Expect = 0.25 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTILAQPGPG 196 SQWS W+ CS CG G + R R L+ G Sbjct: 32 SQWSFWNLCSSSCGQGRRYRYRFCLSLTASG 62 >SB_38612| Best HMM Match : TSP_1 (HMM E-Value=3.3e-11) Length = 900 Score = 33.1 bits (72), Expect = 0.25 Identities = 17/38 (44%), Positives = 19/38 (50%), Gaps = 5/38 (13%) Frame = -1 Query: 282 WSDW----SKCSQPCGVGYQERVRTIL-AQPGPGGVPC 184 WSDW S CS CG G Q + RT +P GG C Sbjct: 366 WSDWPADYSTCSYTCGGGVQWKTRTCTNPKPARGGADC 403 Score = 31.9 bits (69), Expect = 0.59 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -1 Query: 321 TLTGSPGDCQVSQW--SDWSKCSQPCGVGYQER 229 T T +PG+ Q+ W ++WS CS CG G Q R Sbjct: 705 TATCTPGE-QIPTWYTTEWSPCSATCGRGTQSR 736 Score = 28.7 bits (61), Expect = 5.5 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 6/47 (12%) Frame = -1 Query: 351 VPLSNGVGG-PTLTGSPGDCQVS---QW--SDWSKCSQPCGVGYQER 229 +P S+ +G PT+T S +V+ +W S WS CSQ C G Q R Sbjct: 754 LPDSSCIGSKPTVTSSQECNKVNCPAEWVSSAWSACSQTCAGGQQTR 800 >SB_32913| Best HMM Match : TSP_1 (HMM E-Value=1.4e-16) Length = 491 Score = 32.7 bits (71), Expect = 0.34 Identities = 19/44 (43%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = -1 Query: 309 SPGDCQVSQWS-DWSKCSQPCGVGYQERVRTIL-AQPGPGGVPC 184 SP D S WS ++S CS CG G Q + RT +P GG C Sbjct: 22 SPVDGGWSDWSAEYSTCSYSCGGGVQWKTRTCTNPKPLRGGADC 65 Score = 31.1 bits (67), Expect = 1.0 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 6/32 (18%) Frame = -1 Query: 306 PGDCQVS----QWSD--WSKCSQPCGVGYQER 229 PG+ VS +W WS CS+ CG+G QER Sbjct: 351 PGNSSVSSSDVEWKTGAWSACSKACGIGSQER 382 Score = 28.7 bits (61), Expect = 5.5 Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = -1 Query: 291 VSQW--SDWSKCSQPCGVGYQER 229 VS W ++WS CS CG G Q R Sbjct: 417 VSSWYTTEWSPCSATCGKGTQSR 439 >SB_11852| Best HMM Match : fn3 (HMM E-Value=1.2e-24) Length = 691 Score = 32.3 bits (70), Expect = 0.44 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -1 Query: 282 WSDWSKCSQPCGVGYQERVR 223 W +WS CS+ CG G + RVR Sbjct: 331 WGEWSTCSRTCGDGVRMRVR 350 >SB_36995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 574 Score = 32.3 bits (70), Expect = 0.44 Identities = 22/66 (33%), Positives = 29/66 (43%), Gaps = 2/66 (3%) Frame = -1 Query: 375 PGLSISSIVPLSNGVGGPTLTGSPGDCQVSQWSDWSKCSQPCGVGYQERVRTILAQPGP- 199 PG++ SS V P +P +W+ WS C + CG G Q R R + P P Sbjct: 243 PGVT-SSNVKTQRVRCSPAECYAPVQGHWGRWARWSTCDKTCGYGKQMRKR-VCDDPKPR 300 Query: 198 -GGVPC 184 GG C Sbjct: 301 NGGKTC 306 >SB_14123| Best HMM Match : TSP_1 (HMM E-Value=1.2e-05) Length = 168 Score = 31.9 bits (69), Expect = 0.59 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = -1 Query: 300 DCQVSQWSDWSKCSQPCG-VGYQERVRTILAQPGPGGVPCPKLMS 169 +C VS WS +S C+ CG G Q R R + GG CP +S Sbjct: 39 NCIVSGWSLYSSCTHHCGNSGTQTRTRRVTRAQECGGT-CPYHLS 82 >SB_13625| Best HMM Match : Reprolysin (HMM E-Value=2.3e-15) Length = 715 Score = 31.9 bits (69), Expect = 0.59 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -1 Query: 285 QWSDWSKCSQPCGVGYQERVR 223 QWS+WS+CS+ CG G R Sbjct: 480 QWSNWSECSRSCGGGVSSSER 500 >SB_2827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 506 Score = 31.9 bits (69), Expect = 0.59 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -1 Query: 285 QWSDWSKCSQPCGVGYQERVRTILAQPGP 199 +WS+WS CS C G Q R R+ A P P Sbjct: 296 RWSEWSSCSVTCDNGVQSRHRSCNA-PAP 323 >SB_41161| Best HMM Match : TSP_1 (HMM E-Value=6e-22) Length = 649 Score = 31.9 bits (69), Expect = 0.59 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVR 223 ++WS +SKCS CGVG + R R Sbjct: 383 TEWSGYSKCSVTCGVGKRTRSR 404 Score = 28.7 bits (61), Expect = 5.5 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -1 Query: 282 WSDWSKCSQPCGVGYQERVR 223 WS +S CS CG G +ER R Sbjct: 304 WSKFSSCSVTCGRGVKERYR 323 >SB_57867| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 890 Score = 31.5 bits (68), Expect = 0.77 Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = -1 Query: 309 SPGDCQVSQWSDWSKCSQPCGVGYQERVRTI-LAQPGPGGVPC 184 +P D +WS W CS+ C G Q R R P GG C Sbjct: 542 APVDGHWGRWSAWGTCSKSCDKGSQTRTRQCDDPTPKNGGSSC 584 >SB_23583| Best HMM Match : TSP_1 (HMM E-Value=0.095) Length = 520 Score = 31.5 bits (68), Expect = 0.77 Identities = 10/21 (47%), Positives = 15/21 (71%), Gaps = 2/21 (9%) Frame = -1 Query: 285 QWSD--WSKCSQPCGVGYQER 229 +W++ WS C++PC GYQ R Sbjct: 7 EWTEGSWSTCTEPCATGYQSR 27 >SB_18253| Best HMM Match : ADAM_spacer1 (HMM E-Value=4e-05) Length = 339 Score = 31.1 bits (67), Expect = 1.0 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 6/32 (18%) Frame = -1 Query: 306 PGDCQVS----QWSD--WSKCSQPCGVGYQER 229 PG+ VS +W WS CS+ CG+G QER Sbjct: 271 PGNSSVSSSDVEWKTGAWSACSKACGIGSQER 302 >SB_39876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 761 Score = 31.1 bits (67), Expect = 1.0 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -1 Query: 309 SPGDCQVSQWSDWSKCSQPCGVGYQERVRTIL 214 +P D +WS W CS+ C GY++ RT L Sbjct: 336 APVDGHWGRWSSWGACSKTC--GYKQHTRTRL 365 >SB_3851| Best HMM Match : TSP_1 (HMM E-Value=3.7e-24) Length = 429 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = -1 Query: 321 TLTGSPGDCQVSQWSDWSKCSQPCGVGYQER-VRTIL 214 T+ G+ +C +WS+CS+ CG+G R V+ IL Sbjct: 197 TVCGTSQECPKWIIGNWSQCSRTCGIGITSREVQCIL 233 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -1 Query: 303 GDCQVSQWSDWSKCSQPCGVGYQERVRT 220 G C Q WS+CS CG G Q R T Sbjct: 151 GPCATWQTGTWSQCSVTCGKGTQVRTVT 178 >SB_43343| Best HMM Match : fn3 (HMM E-Value=3.4e-39) Length = 2865 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -1 Query: 291 VSQWSDWSKCSQPCGVGYQERVR 223 + WS WS CS+ C G Q R R Sbjct: 1592 IDTWSQWSVCSRSCAAGKQIRKR 1614 >SB_34822| Best HMM Match : EGF_CA (HMM E-Value=8.9e-09) Length = 87 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = -1 Query: 672 QRPCSDRDDCTIDMLTAKRICMEEPTQ--GPCRGLYQ 568 QR C+D D+C T +++C+ P CRG Y+ Sbjct: 40 QRHCADHDECATRNNTCEQLCLNHPGHYTCDCRGGYE 76 >SB_47693| Best HMM Match : TSP_1 (HMM E-Value=2.3e-09) Length = 168 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -1 Query: 288 SQWSDWSKCSQPCGV-GYQERVRTILAQPGPGGVPCP 181 S W+ W+ C + CG G +ER RT GG CP Sbjct: 4 SDWTGWTTCDRTCGAGGKRERSRTC-----QGGSNCP 35 >SB_43620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1680 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -1 Query: 288 SQWSDWSKCSQPCGV-GYQERVRTILAQPGPGGVPCP 181 S W+ W+ C + CG G +ER RT GG CP Sbjct: 4 SDWTGWTTCDRTCGAGGKRERSRTC-----QGGSNCP 35 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/32 (40%), Positives = 15/32 (46%), Gaps = 3/32 (9%) Frame = -1 Query: 285 QWSDWSKCSQPCGVGYQERVRTILAQ---PGP 199 +WS WS C + CG G R R PGP Sbjct: 227 EWSTWSPCMKTCGTGVMMRQRDCFTGSNCPGP 258 >SB_25565| Best HMM Match : TSP_1 (HMM E-Value=0.0032) Length = 88 Score = 30.3 bits (65), Expect = 1.8 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 273 WSKCSQPCGVGYQERV 226 WS+CS PCG G Q+R+ Sbjct: 35 WSECSVPCGGGMQKRI 50 >SB_47335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 29.9 bits (64), Expect = 2.4 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 276 DWSKCSQPCGVGYQERVRTILAQP 205 DWS CS CG G Q R T+ P Sbjct: 48 DWSTCSASCGRGVQTRNNTMCQYP 71 >SB_45482| Best HMM Match : BTB (HMM E-Value=5.6e-11) Length = 3037 Score = 29.5 bits (63), Expect = 3.1 Identities = 16/66 (24%), Positives = 30/66 (45%) Frame = -3 Query: 334 CWWSYPDGKSRRLSGEPVERLEQVQPALRSRLPGARQDYSCTARPGRSAVSEANVAAPTV 155 C+ P L+ +E+LEQ P+ + PG A + ++S+ ++ TV Sbjct: 1800 CFAECPGADDSLLAAVDIEQLEQELPSKGTPSPGRETKVHSRATYSQQSLSQGSITQRTV 1859 Query: 154 LQAVLS 137 Q V++ Sbjct: 1860 TQQVVT 1865 >SB_37175| Best HMM Match : GvpH (HMM E-Value=2.5) Length = 340 Score = 29.5 bits (63), Expect = 3.1 Identities = 16/66 (24%), Positives = 30/66 (45%) Frame = -3 Query: 334 CWWSYPDGKSRRLSGEPVERLEQVQPALRSRLPGARQDYSCTARPGRSAVSEANVAAPTV 155 C+ P L+ +E+LEQ P+ + PG A + ++S+ ++ TV Sbjct: 231 CFAECPGADDSLLAAVDIEQLEQELPSKGTPSPGRETKVHSRATYSQQSLSQGSITQRTV 290 Query: 154 LQAVLS 137 Q V++ Sbjct: 291 TQQVVT 296 >SB_32009| Best HMM Match : PKD (HMM E-Value=1.9e-19) Length = 3083 Score = 29.5 bits (63), Expect = 3.1 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -1 Query: 306 PGDCQVSQWSDWSKCSQPCGV 244 P D S+W+ WS C CGV Sbjct: 253 PRDSGFSEWAAWSTCPNSCGV 273 >SB_9137| Best HMM Match : SCP (HMM E-Value=3.6e-18) Length = 708 Score = 29.5 bits (63), Expect = 3.1 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -1 Query: 285 QWSDWSKCSQPCGVGYQERVR 223 +W+ WS CS CG G + R R Sbjct: 492 EWNGWSTCSVSCGSGSKMRAR 512 >SB_4595| Best HMM Match : TSP_1 (HMM E-Value=2.5e-05) Length = 143 Score = 29.5 bits (63), Expect = 3.1 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -1 Query: 300 DCQVSQWSDWSKCSQPCG-VGYQERVRTILAQPGPGGVPCP 181 +C VS W +S CS CG G + R R + +P CP Sbjct: 38 NCVVSSWGAYSDCSHQCGNSGTRTRTRRV-TEPQKCDGKCP 77 >SB_58665| Best HMM Match : TSP_1 (HMM E-Value=7.5e-10) Length = 718 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRT-ILAQPGPGGVPC 184 + W+ WS+CS G G++ R R + P GG C Sbjct: 354 TNWAAWSQCSVTQGSGFRVRTRACVNPPPRNGGRKC 389 >SB_57196| Best HMM Match : ADAM_spacer1 (HMM E-Value=3.1e-31) Length = 718 Score = 29.1 bits (62), Expect = 4.1 Identities = 10/22 (45%), Positives = 15/22 (68%), Gaps = 2/22 (9%) Frame = -1 Query: 285 QWS--DWSKCSQPCGVGYQERV 226 +W+ +W +CS CG GYQ R+ Sbjct: 613 EWATGNWGECSAKCGSGYQRRL 634 >SB_50961| Best HMM Match : Trypsin (HMM E-Value=0) Length = 1007 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 288 SQWSDWSKCSQPCGVGYQERVRTILAQPGPGG 193 S+WS WS C++ C G+ R R P P G Sbjct: 363 SEWSRWSDCTRTCNGGHTLRSRK-CNNPTPQG 393 >SB_38710| Best HMM Match : 7tm_1 (HMM E-Value=4.6e-09) Length = 435 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -3 Query: 421 AFAGTSTVARRQFQLSRTQYQLHCAS 344 A+ G+ TV +R F+L QY LHC+S Sbjct: 185 AYPGSITVLKR-FELGEGQYTLHCSS 209 >SB_12542| Best HMM Match : Collagen (HMM E-Value=1.3) Length = 532 Score = 29.1 bits (62), Expect = 4.1 Identities = 18/66 (27%), Positives = 32/66 (48%), Gaps = 4/66 (6%) Frame = -1 Query: 360 SSIVPLSNGVGGPT--LTGSPGDCQVSQWSDWSKCSQPCGVGYQERVRTILAQPGP--GG 193 ++++ + NG G P + G C+V+ WS S+ G GY + T++ + GG Sbjct: 225 AAVLIVVNGTGVPDRLIVSFRGCCRVNCNWYWSGWSRCTGCGYSTQSSTVVIRTAASCGG 284 Query: 192 VPCPKL 175 CP + Sbjct: 285 TACPSV 290 >SB_7281| Best HMM Match : TSP_1 (HMM E-Value=0.027) Length = 406 Score = 28.7 bits (61), Expect = 5.5 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -1 Query: 300 DCQVSQWSDWSKCSQPC 250 D +QWS WS C Q C Sbjct: 338 DASYNQWSQWSACPQSC 354 >SB_5639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1384 Score = 28.7 bits (61), Expect = 5.5 Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 2/26 (7%) Frame = -1 Query: 300 DCQVSQWS--DWSKCSQPCGVGYQER 229 DC V +W+ WSKCS CG G + R Sbjct: 297 DCPV-EWNIGPWSKCSVSCGEGIRRR 321 >SB_59407| Best HMM Match : Toxin_4 (HMM E-Value=4.4) Length = 49 Score = 28.7 bits (61), Expect = 5.5 Identities = 13/24 (54%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -1 Query: 288 SQWS-DWSKCSQPCGVGYQERVRT 220 S WS D+S CS CG G Q + RT Sbjct: 21 SNWSADYSTCSYTCGGGVQWKTRT 44 >SB_19793| Best HMM Match : TSP_1 (HMM E-Value=0.0027) Length = 384 Score = 28.7 bits (61), Expect = 5.5 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 282 WSDWSKCSQPCGVGYQERVR 223 W D+S CS+ CG G + R R Sbjct: 129 WGDYSTCSRTCGGGVRHRSR 148 >SB_11766| Best HMM Match : Reprolysin (HMM E-Value=1.6e-08) Length = 469 Score = 28.7 bits (61), Expect = 5.5 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 282 WSDWSKCSQPCGVGYQERVR 223 W D+S CS+ CG G + R R Sbjct: 444 WGDYSTCSRTCGGGVRHRSR 463 >SB_31319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1186 Score = 27.9 bits (59), Expect = 9.5 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -1 Query: 279 SDWSKCSQPCGVGYQERVRTILAQPG 202 + W KCS CG G Q R+ L G Sbjct: 1090 TSWQKCSTTCGGGSQHRIVMCLNDQG 1115 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,459,460 Number of Sequences: 59808 Number of extensions: 447831 Number of successful extensions: 1457 Number of sequences better than 10.0: 115 Number of HSP's better than 10.0 without gapping: 1135 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1450 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2083999566 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -