BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10k07r (768 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 28 0.37 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 28 0.37 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 27 0.64 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 27 0.64 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 27 0.84 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 26 1.5 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 25 3.4 AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 24 4.5 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 23 7.9 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 27.9 bits (59), Expect = 0.37 Identities = 13/50 (26%), Positives = 25/50 (50%) Frame = +1 Query: 442 STEHNLASVHTVFLREEVVLAAATSAVVEGNAHPLHGHEGPALVQSSARP 591 +T H+ H + V A A+ + +A ++ H PA+V++ A+P Sbjct: 29 ATSHSTIQHHAAPTIQHVGSVHAAPAIYQHSAPAIYQHSAPAIVKTIAQP 78 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 27.9 bits (59), Expect = 0.37 Identities = 13/50 (26%), Positives = 25/50 (50%) Frame = +1 Query: 442 STEHNLASVHTVFLREEVVLAAATSAVVEGNAHPLHGHEGPALVQSSARP 591 +T H+ H + V A A+ + +A ++ H PA+V++ A+P Sbjct: 29 ATSHSTIQHHAAPTIQHVGSVHAAPAIYQHSAPAIYQHSAPAIVKTIAQP 78 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 27.1 bits (57), Expect = 0.64 Identities = 13/50 (26%), Positives = 24/50 (48%) Frame = +1 Query: 442 STEHNLASVHTVFLREEVVLAAATSAVVEGNAHPLHGHEGPALVQSSARP 591 +T H+ H V A A+ + +A ++ H PA+V++ A+P Sbjct: 29 ATSHSTIQHHAAPAIHHVGSVHAAPAIYQHSAPAIYQHSAPAIVKTIAQP 78 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 27.1 bits (57), Expect = 0.64 Identities = 13/50 (26%), Positives = 24/50 (48%) Frame = +1 Query: 442 STEHNLASVHTVFLREEVVLAAATSAVVEGNAHPLHGHEGPALVQSSARP 591 +T H+ H V A A+ + +A ++ H PA+V++ A+P Sbjct: 29 ATSHSTIQHHAAPAIHHVGSVHAAPAIYQHSAPAIYQHSAPAIVKTIAQP 78 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 26.6 bits (56), Expect = 0.84 Identities = 13/50 (26%), Positives = 24/50 (48%) Frame = +1 Query: 442 STEHNLASVHTVFLREEVVLAAATSAVVEGNAHPLHGHEGPALVQSSARP 591 +T H+ H V A A+ + +A ++ H PA+V++ A+P Sbjct: 29 ATSHSSIQHHAAPAIHHVGSVHAAPAIYQHSAPAIYQHSAPAIVKTIAQP 78 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 25.8 bits (54), Expect = 1.5 Identities = 13/48 (27%), Positives = 22/48 (45%) Frame = +1 Query: 442 STEHNLASVHTVFLREEVVLAAATSAVVEGNAHPLHGHEGPALVQSSA 585 +T H+ H + V A A+ + +A ++ H PA+ Q SA Sbjct: 29 ATSHSTIQHHAAPAIQHVGSVHAAPAIYQHSAPAIYQHSAPAIYQHSA 76 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 24.6 bits (51), Expect = 3.4 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 5/56 (8%) Frame = -1 Query: 330 GGPTLTGSPGDCQVSQWSDW--SKCSQPCGVGYQERVR---TILAQPGPGGVPCPK 178 G P LTG G+ + W D S S P G ++ R ++ +PG G+P P+ Sbjct: 562 GPPGLTGEKGEPGLPVWKDRGPSGPSGPLGPQGEKGDRGDSGLMGRPGNDGLPGPQ 617 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 24.2 bits (50), Expect = 4.5 Identities = 17/57 (29%), Positives = 25/57 (43%), Gaps = 4/57 (7%) Frame = -3 Query: 523 LRRMSRQPEQLPHARRLYEHLQDYARWSSA--GGISAFAG--TSTVARRQFQLSRTQ 365 + R R+ ++ H R Y + D RW S GG+ F S+ +QL R Q Sbjct: 851 MERWQREWDESVHGRWTYRLIPDVNRWISRRFGGVDFFLSQFLSSHGFYAYQLHRMQ 907 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 23.4 bits (48), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 602 NPLKGRAEDCTSAGPSWP 549 NPLKG+ +C S+G P Sbjct: 1140 NPLKGKLTNCHSSGCERP 1157 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 711,175 Number of Sequences: 2352 Number of extensions: 14722 Number of successful extensions: 32 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79834176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -