BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10k07r (768 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 24 1.4 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 23 3.1 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 4.1 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 4.1 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 21 9.5 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 21 9.5 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 21 9.5 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 24.2 bits (50), Expect = 1.4 Identities = 21/73 (28%), Positives = 28/73 (38%), Gaps = 5/73 (6%) Frame = -3 Query: 331 WWSYPDGKSRRLSGEPVERLEQVQPALRSRLPGARQD--YSCTAR---PGRSAVSEANVA 167 W+ + +G SRR + ER+ QV L R Y C G S + V Sbjct: 246 WYKFIEGSSRRQPVQLNERVRQVSGTLIIREARVEDSGKYLCIVNNSVGGESVETVLTVT 305 Query: 166 APTVLQAVLSTHT 128 AP + ST T Sbjct: 306 APLGAEIEPSTQT 318 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 567 AGTVLCTALEWVPPYICVWR 626 AGT+L L W+ Y C+W+ Sbjct: 177 AGTLL---LVWILCYFCIWK 193 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 22.6 bits (46), Expect = 4.1 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +3 Query: 567 AGTVLCTALEWVPPYICVWR*ACRW 641 AGT+ A+ W+ Y C+W+ +W Sbjct: 210 AGTL---AVVWIMCYFCIWK-GVKW 230 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 22.6 bits (46), Expect = 4.1 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +3 Query: 567 AGTVLCTALEWVPPYICVWR*ACRW 641 AGT+ A+ W+ Y C+W+ +W Sbjct: 263 AGTL---AVVWIMCYFCIWK-GVKW 283 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -1 Query: 234 ERVRTILAQPGPGGVP 187 E ++T PGP GVP Sbjct: 323 ESMKTARENPGPPGVP 338 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -1 Query: 234 ERVRTILAQPGPGGVP 187 E ++T PGP GVP Sbjct: 323 ESMKTARENPGPPGVP 338 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -1 Query: 234 ERVRTILAQPGPGGVP 187 E ++T PGP GVP Sbjct: 262 ESMKTARENPGPPGVP 277 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,702 Number of Sequences: 438 Number of extensions: 4075 Number of successful extensions: 11 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24032646 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -