BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10j19f (651 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. 25 0.84 DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 23 3.4 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 23 3.4 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 22 4.5 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 4.5 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 21 7.8 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 21 7.8 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 7.8 >DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. Length = 143 Score = 24.6 bits (51), Expect = 0.84 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +2 Query: 509 SCSGVQSSNRCKPSLDNTNCLH 574 SCS V SS++C+ S C++ Sbjct: 112 SCSNVDSSDKCEKSFMFMKCMY 133 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 22.6 bits (46), Expect = 3.4 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -1 Query: 393 VNCRILASKLLQL*AILPTRTKLLSTIVYHT 301 V+ ++ L L + L TRTKL T +HT Sbjct: 13 VSSCVIFGVLFVLFSFLRTRTKLQPTYFHHT 43 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 22.6 bits (46), Expect = 3.4 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -1 Query: 393 VNCRILASKLLQL*AILPTRTKLLSTIVYHT 301 V+ ++ L L + L TRTKL T +HT Sbjct: 13 VSSCVIFGVLFVLFSFLRTRTKLQPTYFHHT 43 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/41 (24%), Positives = 21/41 (51%) Frame = +3 Query: 384 YNLQITSTYEYLRLRFNQKVRLLGSVIFIIKMLLYIPIVIY 506 YN + Y Y +N +L ++ +I ++ + +P+ IY Sbjct: 96 YNNNNYNNYNYNNNNYNNYKKLYYNINYIEQIPVPVPVPIY 136 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 22.2 bits (45), Expect = 4.5 Identities = 7/18 (38%), Positives = 8/18 (44%) Frame = -2 Query: 608 YSTKSCVKYTDNANNWCY 555 Y T CV+Y W Y Sbjct: 715 YETDPCVRYYPRRKEWLY 732 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 21.4 bits (43), Expect = 7.8 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +2 Query: 332 VRVGSIAHNCNNLLASILQFTN 397 +R I +NC +L+AS+ F N Sbjct: 438 LREDVINYNCRSLVASVPFFAN 459 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 21.4 bits (43), Expect = 7.8 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +2 Query: 332 VRVGSIAHNCNNLLASILQFTN 397 +R I +NC +L+AS+ F N Sbjct: 406 LREDVINYNCRSLVASVPFFAN 427 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -2 Query: 218 HCLPAHQIFGSSVLLLTREK 159 +C+P Q+ S++L REK Sbjct: 794 YCVPVPQVNDSTILSPVREK 813 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,460 Number of Sequences: 438 Number of extensions: 4125 Number of successful extensions: 14 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -