BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10j17f (624 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ298317-1|CAC83674.1| 2448|Homo sapiens mucin 5 protein. 34 0.47 AB158503-1|BAD69710.1| 151|Homo sapiens splice variant of four ... 31 4.4 >AJ298317-1|CAC83674.1| 2448|Homo sapiens mucin 5 protein. Length = 2448 Score = 33.9 bits (74), Expect = 0.47 Identities = 42/171 (24%), Positives = 66/171 (38%) Frame = +2 Query: 101 PTSLTTFWRSSFTIASSSPITTVRLKRASIYTRRRRAKSSQMS*TN*YETTR*TAWSTPI 280 PT T+ W+ S T + TT + ++ Y S+ + T TT T S P Sbjct: 2240 PTQSTSSWQKSRTTTLVTTSTTSTPQTSTTYAHTTSTTSAPTARTTSAPTTSTT--SVPT 2297 Query: 281 NFGSRAPRTSSGIVSQLSSDLSSPKTRLSLCTSATVSL*R*AMMFKATMADLPTATARTR 460 P+T+ V S+ ++ + +S T++T S+ T + T RT Sbjct: 2298 TSTISGPKTTPSPVPTTSTTSAATTSTISAPTTSTTSVPGTTPSPVLTTSTTSAPTTRTT 2357 Query: 461 QARESAGS*SLCGXXXXXXXXXXXLNVTNTWYWESALTGTATIWPSESTAS 613 A AG+ S G ++ T SA T + T P+ ST S Sbjct: 2358 SA-SPAGTTSGPGNTPSPVPTTSTISAPTTSI-TSAPTTSTTSAPTSSTTS 2406 >AB158503-1|BAD69710.1| 151|Homo sapiens splice variant of four and a half LIM domain protein 2 protein. Length = 151 Score = 30.7 bits (66), Expect = 4.4 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +2 Query: 266 WSTPINFGSRAPRTSSGIVSQLSSDLSSPKT-RLSLC 373 WST G R +++ SQL +SSPKT R+S+C Sbjct: 57 WSTRAAAGMRPASSATAASSQLEPRVSSPKTIRISVC 93 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 81,091,212 Number of Sequences: 237096 Number of extensions: 1495084 Number of successful extensions: 4138 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3984 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4136 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6747805200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -