BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10j16f (573 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23H4.04 |||tRNA|Schizosaccharomyces pombe|chr 1|||Manual 26 4.5 SPBP8B7.27 |mug30||ubiquitin-protein ligase E3|Schizosaccharomyc... 25 7.9 >SPAC23H4.04 |||tRNA|Schizosaccharomyces pombe|chr 1|||Manual Length = 415 Score = 25.8 bits (54), Expect = 4.5 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 140 QNNLTSCYSWWLINTHYTKNKVN 72 +NN+ WWL + HY K+ VN Sbjct: 147 ENNVKG--DWWLASGHYAKSVVN 167 >SPBP8B7.27 |mug30||ubiquitin-protein ligase E3|Schizosaccharomyces pombe|chr 2|||Manual Length = 807 Score = 25.0 bits (52), Expect = 7.9 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = -3 Query: 304 LAKGLAPLRRLIFLIYFYSTLFSEVDSASLFCSLKKSAKN 185 +A GL PLR LI L++ + +++ S CS++ S N Sbjct: 161 VAAGL-PLRELISLVFGSPPILNKLFSVKNGCSIQSSGLN 199 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,099,555 Number of Sequences: 5004 Number of extensions: 39337 Number of successful extensions: 105 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 103 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 105 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 244081442 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -