BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10j14r (748 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1457 - 33741048-33741146,33741647-33741760,33741938-337420... 34 0.14 11_05_0063 - 18756289-18756390,18756769-18756954,18757053-187572... 29 5.2 09_06_0134 + 21065104-21065965,21066732-21066961,21067618-210678... 29 5.2 03_02_0243 - 6744164-6744415,6744518-6745135 29 5.2 05_06_0085 + 25441460-25443504,25444263-25444536,25445091-25445468 28 9.1 03_01_0510 + 3841630-3844089,3844235-3844358,3844641-3844786,384... 28 9.1 >04_04_1457 - 33741048-33741146,33741647-33741760,33741938-33742052, 33742154-33742560,33743342-33743476,33743576-33743970, 33744225-33744916,33745014-33745097,33745195-33745286, 33745374-33745457,33745535-33745714,33746258-33746302, 33746399-33746692,33747199-33747585,33747713-33747899, 33748042-33748118,33748936-33749067,33749315-33749416, 33749744-33749827,33749902-33749992,33750105-33750178, 33750644-33750664,33751433-33751477,33752427-33752561, 33752693-33752752 Length = 1376 Score = 33.9 bits (74), Expect = 0.14 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +2 Query: 263 DSLGVGSYG*TNTNSWKGNPSYVPLGSISLEGIVSEELNMSVGIFPW 403 D +G G+YG N +V + +SLE I E+LN+ + F W Sbjct: 24 DEIGKGAYGRVYKGLDLENGDFVAIKQVSLENIPQEDLNIIMSTFMW 70 >11_05_0063 - 18756289-18756390,18756769-18756954,18757053-18757223, 18757339-18757383,18758087-18758260,18758801-18758887, 18759349-18759510,18759945-18760015,18760296-18760435, 18760828-18760952,18761329-18761463,18762069-18762314, 18762530-18762755,18763039-18763091 Length = 640 Score = 28.7 bits (61), Expect = 5.2 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -2 Query: 303 FVFVYPYEPTPKESEPFKSVVPDNKPFGYPFDR 205 F +PYEPTP +++ F V D P DR Sbjct: 79 FTAEFPYEPTPDQNQAFIDVDKDLTERETPMDR 111 >09_06_0134 + 21065104-21065965,21066732-21066961,21067618-21067841, 21067929-21068781 Length = 722 Score = 28.7 bits (61), Expect = 5.2 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +1 Query: 286 RIDEYKQLEGESIVCTLRQHQPRRHSVRGVEHVSRNLSLVQEL 414 +I YK+ E + I L +H+P + + + +EH+S ++ L Sbjct: 598 KISAYKRAENKVIETKLLEHRPEQDAKQRMEHLSEKKEMLNVL 640 >03_02_0243 - 6744164-6744415,6744518-6745135 Length = 289 Score = 28.7 bits (61), Expect = 5.2 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +1 Query: 601 DDGVSGNIRFNIDCHSERLVV 663 D VSG+ RF++ C ERLVV Sbjct: 87 DVRVSGSARFDVQCRGERLVV 107 >05_06_0085 + 25441460-25443504,25444263-25444536,25445091-25445468 Length = 898 Score = 27.9 bits (59), Expect = 9.1 Identities = 22/66 (33%), Positives = 28/66 (42%) Frame = -2 Query: 348 LMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKSVVPDNKPFGYPFDRPVLPQYFKQPNM 169 + LP G YD F +Q F Y + P PF S +P FDR Y Sbjct: 150 VFLPAGLYDRF-YQHFCKGYLW-PLFHYMLPFASALPAAASGDGRFDRGAWEAYVLANKY 207 Query: 168 FFKKVL 151 FF+KV+ Sbjct: 208 FFEKVV 213 >03_01_0510 + 3841630-3844089,3844235-3844358,3844641-3844786, 3844861-3844958,3845313-3845502 Length = 1005 Score = 27.9 bits (59), Expect = 9.1 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = +2 Query: 239 GTTDLNGSDSLGVGSYG*TNTNSWKGNPSYVPLG-SISLEGIVSEELNMSV 388 G TD+ G D G+ +G + +K S PLG ++ V+ LN+SV Sbjct: 55 GDTDVRGMDLNGIVKFGRHSVEVYKDEASKPPLGQGLNKPAEVTLMLNLSV 105 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,749,728 Number of Sequences: 37544 Number of extensions: 362614 Number of successful extensions: 1036 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1008 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1036 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1980691104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -