BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10j11r (732 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0016 + 131141-131236,131743-132043,132125-132341,132440-13... 29 5.0 >03_01_0016 + 131141-131236,131743-132043,132125-132341,132440-132773, 132883-132996,133065-133193,133293-133469,133555-133746, 134844-134981,135327-135559,135900-136003,136633-136727, 136817-137053,137801-137922,138252-138354,138750-138826, 138909-139017,139107-139253,139953-140000,140292-140492, 140589-140738,140917-141002,141088-141193,141278-141373, 141759-141911,142647-142819,142923-142986,144056-144193, 144548-144595,144690-144836,144907-144968,146540-146645, 147357-147461,147548-147679,147765-147974,148070-148171, 148261-148398 Length = 1729 Score = 28.7 bits (61), Expect = 5.0 Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -2 Query: 131 LVSCPLCHFINHIKFFVIMKT-LNVNLVSCLHVI 33 L++CP+CH + + FF I+K C+ V+ Sbjct: 841 LINCPVCHLLCMLLFFHILKVPAQAKAKECIEVL 874 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,483,967 Number of Sequences: 37544 Number of extensions: 235542 Number of successful extensions: 329 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 321 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 329 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1921741964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -