BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10j10r (548 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0638 + 12493520-12494053 121 3e-28 03_04_0162 + 17858802-17861168 30 1.4 11_01_0359 - 2731522-2732346 29 2.4 08_01_0339 - 3003626-3004070,3004467-3004636,3004907-3005020,300... 27 7.5 07_03_0635 + 20151861-20152249,20152589-20152709,20154914-201549... 27 9.9 02_02_0406 - 9888167-9888570,9890168-9890248,9892207-9892600 27 9.9 >02_02_0638 + 12493520-12494053 Length = 177 Score = 121 bits (292), Expect = 3e-28 Identities = 59/145 (40%), Positives = 86/145 (59%), Gaps = 1/145 (0%) Frame = -3 Query: 465 LFAIPFTVLEIPNIKIKKPTWLQAPSAMTTFSLVLLSYFLVTGGIIYDVIVEPPSVGSTT 286 L +PF+ L P +++ P+ L PS MT F+L+LL+YF V G++YDVIVEPP +GS Sbjct: 32 LRVLPFSFLRPPRTRLRLPSNLALPSPMTVFALILLTYFAVVSGLVYDVIVEPPGIGSVQ 91 Query: 285 D-EHGHSRPVAFMPNRVNGQYIMEGLAXXXXXXXXXXXFIILDRTHNPTTPKLNRILLIS 109 D G RPV F+P RVNGQYI+EGL+ I+LD + P+ R+ Sbjct: 92 DPATGAVRPVVFLPGRVNGQYIIEGLSSGIMFVIGGIGIILLDLAVDRNRPRSLRVSFGG 151 Query: 108 VAFLCILVSFFTTWIFMRMKLPGYL 34 I++++ +F+R+K+PGYL Sbjct: 152 SGVAAIVIAYAMAMLFLRIKIPGYL 176 >03_04_0162 + 17858802-17861168 Length = 788 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = -3 Query: 327 YDVIVEPPSVGSTTDEHGHSR-PVAFMP 247 Y V+V+PP G+ TD+ GH R +F+P Sbjct: 56 YIVLVDPPPHGAATDDDGHRRWHESFLP 83 >11_01_0359 - 2731522-2732346 Length = 274 Score = 29.1 bits (62), Expect = 2.4 Identities = 13/40 (32%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = -3 Query: 153 HNPTTPKLNRIL-LISVAFLCILVSFFTTWIFMRMKLPGY 37 H P L R+L L+ AFL + + F W+ +R ++P + Sbjct: 79 HPPPPTCLRRLLGLVVAAFLLLGAATFIVWLLLRPRVPAF 118 >08_01_0339 - 3003626-3004070,3004467-3004636,3004907-3005020, 3005592-3005704,3005848-3005926 Length = 306 Score = 27.5 bits (58), Expect = 7.5 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 410 GFLIFMFGISKTVNGIANSPSISLLLVQ 493 GFL G+ + + +AN PS+ L VQ Sbjct: 23 GFLCVKDGVDEMIKYVANEPSVGLYFVQ 50 >07_03_0635 + 20151861-20152249,20152589-20152709,20154914-20154996, 20155819-20155903,20155987-20156277,20156555-20156645, 20157380-20158280,20158401-20158561,20158759-20158862, 20159040-20159205,20159283-20159378,20159694-20159800, 20160443-20160775,20161393-20161599,20161774-20161857, 20162887-20163020,20163166-20163393,20163541-20163712, 20164301-20164555,20164647-20164919 Length = 1426 Score = 27.1 bits (57), Expect = 9.9 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -3 Query: 135 KLNRILLISVAFLCILVSFFTTWIFMRMKLP 43 K N L I AF ++ F T +F+R K+P Sbjct: 536 KRNSFLFIFKAFQLFVLGFITMTLFLRTKMP 566 >02_02_0406 - 9888167-9888570,9890168-9890248,9892207-9892600 Length = 292 Score = 27.1 bits (57), Expect = 9.9 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 377 PFHWCYSLTFWLLEVLF 327 P WCY +T W L +L+ Sbjct: 185 PLFWCYEITAWGLVILY 201 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,237,821 Number of Sequences: 37544 Number of extensions: 318536 Number of successful extensions: 683 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 677 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 682 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1233951264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -