BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10j10f (601 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z79759-3|CAB02136.1| 225|Caenorhabditis elegans Hypothetical pr... 31 0.83 AF039718-3|AAB96744.1| 329|Caenorhabditis elegans Hypothetical ... 29 1.9 U51994-2|AAA96065.3| 1311|Caenorhabditis elegans Hypothetical pr... 27 7.7 >Z79759-3|CAB02136.1| 225|Caenorhabditis elegans Hypothetical protein ZK858.3 protein. Length = 225 Score = 30.7 bits (66), Expect = 0.83 Identities = 11/39 (28%), Positives = 23/39 (58%) Frame = +3 Query: 168 TTFSLVLLSYFLVTGGIIYDVIVEPPSVGSTTDEHGHSR 284 +T+ L+++ ++ GG++ D E P + ++DE H R Sbjct: 3 STYILIIVPLIIIGGGVVADNTNETPVLAHSSDEQPHQR 41 >AF039718-3|AAB96744.1| 329|Caenorhabditis elegans Hypothetical protein T12F5.2 protein. Length = 329 Score = 29.5 bits (63), Expect = 1.9 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = +2 Query: 443 GVPMYFSVILYHLDIHAYEVARIFTELICKLILYCF 550 G Y +V H+++H +A IF LIC LILY F Sbjct: 296 GSTYYKNVSTEHINLHI--LAPIFINLICILILYVF 329 >U51994-2|AAA96065.3| 1311|Caenorhabditis elegans Hypothetical protein R03G5.3 protein. Length = 1311 Score = 27.5 bits (58), Expect = 7.7 Identities = 10/20 (50%), Positives = 14/20 (70%), Gaps = 2/20 (10%) Frame = -3 Query: 125 YVWNF--QNCKRYCK*PFHF 72 Y+WN+ +NCK + K PF F Sbjct: 995 YIWNYTPENCKLFLKIPFFF 1014 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,472,165 Number of Sequences: 27780 Number of extensions: 312540 Number of successful extensions: 743 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 730 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 743 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1279376318 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -