BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10j06f (629 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC17G9.05 |rct1|cyp6|RRM-containing cyclophilin regulating tra... 28 1.3 SPBC23E6.04c |utp10||U3 snoRNP-associated protein Utp10 |Schizos... 28 1.3 SPAC32A11.01 |mug8||conserved fungal protein|Schizosaccharomyces... 27 1.7 SPAC26F1.09 |gyp51||GTPase activating protein Gyp51 |Schizosacch... 26 5.2 SPCC4G3.14 |mdj1||DNAJ domain protein Mdj1 |Schizosaccharomyces ... 25 6.8 SPAC222.14c |||GTP binding protein Sey1 |Schizosaccharomyces pom... 25 6.8 SPCC1235.09 |||histone deacetylase complex subunit|Schizosacchar... 25 6.8 SPBC2D10.06 |rep1|rec16|MBF transcription factor complex subunit... 25 9.0 >SPBC17G9.05 |rct1|cyp6|RRM-containing cyclophilin regulating transcription Rct1|Schizosaccharomyces pombe|chr 2|||Manual Length = 432 Score = 27.9 bits (59), Expect = 1.3 Identities = 11/24 (45%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 225 RYHSLCQFYNIHHQ--CLVGSHLG 160 +Y++ C FYNI H C G LG Sbjct: 35 KYYNFCPFYNIQHNYTCQTGDPLG 58 >SPBC23E6.04c |utp10||U3 snoRNP-associated protein Utp10 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1649 Score = 27.9 bits (59), Expect = 1.3 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = -3 Query: 627 VNAILSCGFRINEAILHLCYVNFLQHFHIHKHFRVY 520 ++A++ G + ++L C+VN H H+ R+Y Sbjct: 928 ISALIRLGKDFDSSLLVSCFVNAFPHIPQHRRLRLY 963 >SPAC32A11.01 |mug8||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 720 Score = 27.5 bits (58), Expect = 1.7 Identities = 14/56 (25%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Frame = +3 Query: 138 QKKILSFFQDVSQLNTDDEYYKIGKDY-DIEMNMDNYTNKKAVEEFLKMYRTGFMP 302 + K+ D + L DD KD+ ++ +N +Y NK ++ F + + F P Sbjct: 617 EMKLSDKIDDANSLKDDDFIQGSKKDFFEMNLNHSSYQNKDELKPFQLLVKHAFKP 672 >SPAC26F1.09 |gyp51||GTPase activating protein Gyp51 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1031 Score = 25.8 bits (54), Expect = 5.2 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = +3 Query: 150 LSFF--QDVSQLNTDDEYYKIGKDYDIEMNMDN 242 L+FF Q+V Q+N +DEY + + D E +DN Sbjct: 49 LNFFSTQNVMQMNFEDEYSEFSNE-DDEAEIDN 80 >SPCC4G3.14 |mdj1||DNAJ domain protein Mdj1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 528 Score = 25.4 bits (53), Expect = 6.8 Identities = 13/41 (31%), Positives = 16/41 (39%) Frame = +3 Query: 144 KILSFFQDVSQLNTDDEYYKIGKDYDIEMNMDNYTNKKAVE 266 K L + S YYK+ K Y + N D K VE Sbjct: 89 KTLGVSKSASASEIKSAYYKLAKQYHPDANPDKAAQDKFVE 129 >SPAC222.14c |||GTP binding protein Sey1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 762 Score = 25.4 bits (53), Expect = 6.8 Identities = 13/55 (23%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Frame = +3 Query: 129 VEKQKKILSFFQDVSQLNTDDEY---YKIGKDYDIEMNMDNYTNKKAVEEFLKMY 284 +EK K I+ F+ D+ T +EY +K +D+ ++ +++ L++Y Sbjct: 496 IEKIKNIVPFYVDIDDTKTTEEYIINFKKNSWLFFRKKIDSEMSEVLLQQRLRVY 550 >SPCC1235.09 |||histone deacetylase complex subunit|Schizosaccharomyces pombe|chr 3|||Manual Length = 564 Score = 25.4 bits (53), Expect = 6.8 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +1 Query: 433 NQGQFL-YAFYIAVIQRSDCHG 495 N G FL YAF+ VI+ D HG Sbjct: 274 NSGSFLAYAFFSGVIEIYDSHG 295 >SPBC2D10.06 |rep1|rec16|MBF transcription factor complex subunit Rep1|Schizosaccharomyces pombe|chr 2|||Manual Length = 472 Score = 25.0 bits (52), Expect = 9.0 Identities = 8/15 (53%), Positives = 13/15 (86%) Frame = +1 Query: 316 SPFFYDKMRDEAIAL 360 SPF +DK+RDE +++ Sbjct: 83 SPFLFDKIRDEPVSV 97 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,494,417 Number of Sequences: 5004 Number of extensions: 49692 Number of successful extensions: 167 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 144 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 167 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 279695522 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -