BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10j05f (611 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55686| Best HMM Match : Ribosomal_S7 (HMM E-Value=0) 288 2e-78 SB_18806| Best HMM Match : RVT_1 (HMM E-Value=1.7e-14) 28 5.2 SB_23893| Best HMM Match : rve (HMM E-Value=3.1e-24) 28 6.9 SB_11402| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 >SB_55686| Best HMM Match : Ribosomal_S7 (HMM E-Value=0) Length = 272 Score = 288 bits (707), Expect = 2e-78 Identities = 135/164 (82%), Positives = 150/164 (91%) Frame = +1 Query: 118 VVVETMSLPQAADIPEIKLFGRWSCYDVQVSDMSLQDYISVKEKYAKYLPHSAGRYAHKR 297 VV + + A ++P+IKLFG+WS DVQVSD+SL DYI+VKEKY+ YLPH+AGRYA KR Sbjct: 69 VVDDDAAAVVAPEVPDIKLFGKWSTEDVQVSDISLTDYIAVKEKYSTYLPHTAGRYAAKR 128 Query: 298 FRKAQCPIVERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSG 477 FRKAQCPIVER+TNS+MMHGRNNGKKLM VRI+KH+FEIIHLLTGENPLQVLV AIINSG Sbjct: 129 FRKAQCPIVERITNSMMMHGRNNGKKLMTVRIIKHSFEIIHLLTGENPLQVLVNAIINSG 188 Query: 478 PREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFR 609 PREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGARE+AFR Sbjct: 189 PREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGARESAFR 232 Score = 42.3 bits (95), Expect = 3e-04 Identities = 19/35 (54%), Positives = 26/35 (74%) Frame = +1 Query: 118 VVVETMSLPQAADIPEIKLFGRWSCYDVQVSDMSL 222 VV + + A ++P+IKLFG+WS DVQVSD+SL Sbjct: 6 VVDDDAAAVVAPEVPDIKLFGKWSTEDVQVSDISL 40 >SB_18806| Best HMM Match : RVT_1 (HMM E-Value=1.7e-14) Length = 556 Score = 28.3 bits (60), Expect = 5.2 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +1 Query: 157 IPEIKLFGRWSCYDVQVSDMSLQDYISVKEKYAKYLPHSAGRYA 288 IPE L C DV + LQ+++ + +KY YL + A +Y+ Sbjct: 511 IPEEAL--NLECPDVDFRESVLQEFLLLDKKYESYLEYLALKYS 552 >SB_23893| Best HMM Match : rve (HMM E-Value=3.1e-24) Length = 553 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = +2 Query: 26 TVRGYNFYLVIEKYQSWPR--RTGMTT*PR 109 +V G NF++V++ + WP T TT P+ Sbjct: 242 SVHGVNFFVVVDAHSKWPEIIATSSTTAPK 271 >SB_11402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 753 Score = 27.9 bits (59), Expect = 6.9 Identities = 20/109 (18%), Positives = 41/109 (37%), Gaps = 1/109 (0%) Frame = +1 Query: 55 NRKVPIMAEENWNDDVAEAGSVVVETMSLPQAADIPEIKLFGRWSCYDVQVSDMSLQDYI 234 +R+ + E+ W+ ++ G + T P + +L WS V D ++ ++I Sbjct: 619 DRQQRVRIEDEWSSQISPRGGIPQGTRLAPLLFAVLVNRLADEWSTRLKYVDDATVLEFI 678 Query: 235 SVKE-KYAKYLPHSAGRYAHKRFRKAQCPIVERLTNSLMMHGRNNGKKL 378 Y + RYA +R + + + + +G KL Sbjct: 679 PRNSPSYLPIVASGISRYATQRNMRLNPNKCKEMVIDFLHYGEQQKHKL 727 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,165,609 Number of Sequences: 59808 Number of extensions: 424017 Number of successful extensions: 1086 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1013 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1086 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1499981500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -