BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10j04f (566 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 22 3.7 DQ435331-1|ABD92646.1| 135|Apis mellifera OBP14 protein. 21 6.5 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 21 8.6 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 22.2 bits (45), Expect = 3.7 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -3 Query: 522 RNTDSNKAISREYPFVHLHGSFLVNV 445 +N ++N S ++ HL G+ VNV Sbjct: 116 KNQNNNHYTSHQHLRTHLRGTLTVNV 141 >DQ435331-1|ABD92646.1| 135|Apis mellifera OBP14 protein. Length = 135 Score = 21.4 bits (43), Expect = 6.5 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = +1 Query: 130 KTVLFCECVIAN 165 K L+CEC++ N Sbjct: 58 KVQLYCECILKN 69 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 21.0 bits (42), Expect = 8.6 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +2 Query: 200 CLVFLLSITEASDEAKVDKVHVDCSTLRLG 289 C++ + S ++K + VH+ STL G Sbjct: 252 CVIAFATSALVSKDSKFNMVHIQNSTLAGG 281 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,604 Number of Sequences: 438 Number of extensions: 3566 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16440594 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -