BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10i24r (761 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50648| Best HMM Match : Atrophin-1 (HMM E-Value=1.3) 28 7.2 SB_28448| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 >SB_50648| Best HMM Match : Atrophin-1 (HMM E-Value=1.3) Length = 1281 Score = 28.3 bits (60), Expect = 7.2 Identities = 19/46 (41%), Positives = 25/46 (54%) Frame = +2 Query: 17 KQPLRDCSSQ*TMAVEQTRGSYRSGNISYYSMVRGFPAQYRGRLTD 154 KQ RD SQ T + RG NI+ +S G PA+ RGR++D Sbjct: 498 KQITRDNQSQNTPVLPSKRGK----NINPHSRGTGRPARGRGRVSD 539 >SB_28448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1333 Score = 28.3 bits (60), Expect = 7.2 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = -1 Query: 227 ETYVQIVLISCRNQGIAVEPPTQRHLSDGHGTVPG 123 E +++ ++ ++ + V PPT +H S G G PG Sbjct: 106 ELSIELKNVTSSSRQVRVVPPTSKHFSIGLGRFPG 140 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,580,576 Number of Sequences: 59808 Number of extensions: 421550 Number of successful extensions: 872 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 830 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 872 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2082369341 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -