BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10i24r (761 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z30317-4|CAB54306.1| 378|Caenorhabditis elegans Hypothetical pr... 29 3.6 Z92812-6|CAB07280.1| 372|Caenorhabditis elegans Hypothetical pr... 29 4.8 >Z30317-4|CAB54306.1| 378|Caenorhabditis elegans Hypothetical protein T16G12.8 protein. Length = 378 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -1 Query: 335 YNILMYKSAFNFNVESSECYSHIQLYVVSI 246 YNILMY SA + NV++ EC Y + + Sbjct: 68 YNILMYYSASSTNVKTLECAQKCSKYGIVV 97 >Z92812-6|CAB07280.1| 372|Caenorhabditis elegans Hypothetical protein T03E6.6 protein. Length = 372 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/43 (27%), Positives = 26/43 (60%) Frame = +1 Query: 526 VVCINRVLLTSMVNILGVGSRHGNIFIFGIQKGLIVYEIIKSD 654 +V +R + TS +N+L +G ++ I G G+ +Y+I++ + Sbjct: 71 LVISHRKMWTSSINVLMIGISFCDVLIIGNTFGMRIYDILQQN 113 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,477,446 Number of Sequences: 27780 Number of extensions: 334881 Number of successful extensions: 581 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 570 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 581 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1819579054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -