BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10i24r (761 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 22 5.4 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 22 5.4 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 22 7.1 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 22 7.1 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 22.2 bits (45), Expect = 5.4 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -1 Query: 608 KIKILPCLLPTP 573 +++ LPCLLP P Sbjct: 622 ELRTLPCLLPRP 633 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 22.2 bits (45), Expect = 5.4 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -1 Query: 608 KIKILPCLLPTP 573 +++ LPCLLP P Sbjct: 590 ELRTLPCLLPRP 601 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 21.8 bits (44), Expect = 7.1 Identities = 7/30 (23%), Positives = 13/30 (43%), Gaps = 3/30 (10%) Frame = +1 Query: 133 VPWPSD---RWRWVGGSTAIPWFRQLINTI 213 +PW + +W G T PW ++ + Sbjct: 335 IPWDKNVEALAKWANGQTGFPWIDAIMTQL 364 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.8 bits (44), Expect = 7.1 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = -1 Query: 68 FVRQPLFTENCSHVEVVC 15 +VR+ F+E+C E++C Sbjct: 426 YVREIAFSESCLPEEILC 443 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 203,377 Number of Sequences: 438 Number of extensions: 4618 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23789892 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -