BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10i23r (720 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12544| Best HMM Match : DUF1218 (HMM E-Value=2.7) 27 0.58 SB_26361| Best HMM Match : fn3 (HMM E-Value=0) 30 2.2 SB_9107| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_8264| Best HMM Match : 7tm_1 (HMM E-Value=4.5e-06) 28 6.6 SB_47160| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 >SB_12544| Best HMM Match : DUF1218 (HMM E-Value=2.7) Length = 290 Score = 27.1 bits (57), Expect(2) = 0.58 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = -2 Query: 611 VNNLIIDKRRNTMEYCYKLWVGNGQDIV 528 +++L++ +++ YC+ NGQDIV Sbjct: 130 IHDLLLSLQKHLFAYCHNATSNNGQDIV 157 Score = 23.4 bits (48), Expect(2) = 0.58 Identities = 14/51 (27%), Positives = 22/51 (43%) Frame = -2 Query: 530 VKKYFPLSFRLIMAGNYVKLIYRNYNLALKLGSTTNPSNERIAYGDGVDKH 378 ++ YF L+M+G L+ + +L L S R+ G G D H Sbjct: 183 IRYYFACFQELLMSGPANSLLQSHLSLFLPCAGEILGSVYRLLVGHGSDTH 233 >SB_26361| Best HMM Match : fn3 (HMM E-Value=0) Length = 1898 Score = 29.9 bits (64), Expect = 2.2 Identities = 27/74 (36%), Positives = 34/74 (45%), Gaps = 5/74 (6%) Frame = -2 Query: 446 LKLGSTTNPSNERIAYGDGVDKHTELVSWKFITLWENNRVYFKAHNTKYNQYLKMS---- 279 L+ GST S++ IA +T L S F R Y AH T Y YL +S Sbjct: 868 LESGSTLLASDDGIAPNKRTKVYTSLSSDVFY------RFYVYAHTT-YTTYLCLSVNAP 920 Query: 278 -TSTCNCNARDRVV 240 T C N+RDRV+ Sbjct: 921 CTQACRLNSRDRVL 934 >SB_9107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 29.9 bits (64), Expect = 2.2 Identities = 16/34 (47%), Positives = 19/34 (55%) Frame = -1 Query: 183 VRKRRPVLHLQPRIQRCLGARYDRERLGRPQGRW 82 V +RRP IQR L + DR+ LGR Q RW Sbjct: 9 VIRRRPGGKAFTCIQRFLSSTNDRDLLGRQQSRW 42 >SB_8264| Best HMM Match : 7tm_1 (HMM E-Value=4.5e-06) Length = 309 Score = 28.3 bits (60), Expect = 6.6 Identities = 16/27 (59%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = -1 Query: 156 LQPRIQRCLGA-RYDRERLGRPQGRWT 79 LQPRI RC GA RYD + R GR T Sbjct: 210 LQPRISRCPGARRYDMHK-ARESGRET 235 >SB_47160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1806 Score = 28.3 bits (60), Expect = 6.6 Identities = 22/72 (30%), Positives = 32/72 (44%), Gaps = 2/72 (2%) Frame = -2 Query: 521 YFPLSFRLIMAGN--YVKLIYRNYNLALKLGSTTNPSNERIAYGDGVDKHTELVSWKFIT 348 YFP RLI + NY LA+ LG + + S + G+ VD+ W F Sbjct: 1387 YFPHMARLIDGQKPWCMSSSSSNYWLAIDLGVSVDVSAVEVK-GNDVDEDINQWIWDFSV 1445 Query: 347 LWENNRVYFKAH 312 + N+ V +K H Sbjct: 1446 EYSNDYVQWKQH 1457 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,408,715 Number of Sequences: 59808 Number of extensions: 408879 Number of successful extensions: 1475 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1363 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1475 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1913853903 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -