BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10i20r (739 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_03_0025 + 11739930-11740493,11740820-11741020,11741143-117412... 29 2.9 07_03_0458 + 18406844-18408877 28 6.7 >01_03_0025 + 11739930-11740493,11740820-11741020,11741143-11741235, 11741355-11742125 Length = 542 Score = 29.5 bits (63), Expect = 2.9 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +3 Query: 546 SQPAQAALS*LTVKMIYQSSDKSHSTYSLKMAPLINP 656 S PA A+ K +++ +DK TYS +++P + P Sbjct: 241 SDPAYASRLVARAKRVFEFADKHRGTYSTRLSPYVCP 277 >07_03_0458 + 18406844-18408877 Length = 677 Score = 28.3 bits (60), Expect = 6.7 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 4/54 (7%) Frame = +3 Query: 252 KSVLYLLRAIHK----HVTIYEFIKIKQSLLVQEMTNVLFLYPLNQALTLKHYN 401 KS + + RAI K H+ FI IK S+ E+ +FLY + + ++H N Sbjct: 379 KSSVLIQRAIGKICMGHLKNIRFIVIKMSVEADEIWKEMFLYEMIKQSRIEHCN 432 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,601,468 Number of Sequences: 37544 Number of extensions: 211862 Number of successful extensions: 238 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 237 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 238 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1945321620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -