BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10i17r (720 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 47 1e-07 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 47 1e-07 EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D pro... 23 2.5 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 47.2 bits (107), Expect = 1e-07 Identities = 34/107 (31%), Positives = 56/107 (52%), Gaps = 3/107 (2%) Frame = -1 Query: 528 VSLPKGYETNLGANGA--QLSGGQKQRVCIARALIRSPRLLLLDEATSALDASSERAVTE 355 ++L K T +G G +SGG+K+R+ A ++ +P+L+ DE TS LD+ V + Sbjct: 201 LALSKCQNTPIGILGRIKGISGGEKKRLSFAAEVLTNPKLMFCDEPTSGLDSFMALTVMQ 260 Query: 354 AL-EKAAKGRTCITIAHRLSTVKDADLICVIDKGKIVERGTHAELVS 217 L E A G+T I H+ S +++ + DK ++ G A L S Sbjct: 261 VLKEMAMTGKTVICTIHQPS----SEVYSMFDKLLLMSEGRTAFLGS 303 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 47.2 bits (107), Expect = 1e-07 Identities = 34/107 (31%), Positives = 56/107 (52%), Gaps = 3/107 (2%) Frame = -1 Query: 528 VSLPKGYETNLGANGA--QLSGGQKQRVCIARALIRSPRLLLLDEATSALDASSERAVTE 355 ++L K T +G G +SGG+K+R+ A ++ +P+L+ DE TS LD+ V + Sbjct: 201 LALSKCQNTPIGILGRIKGISGGEKKRLSFAAEVLTNPKLMFCDEPTSGLDSFMALTVMQ 260 Query: 354 AL-EKAAKGRTCITIAHRLSTVKDADLICVIDKGKIVERGTHAELVS 217 L E A G+T I H+ S +++ + DK ++ G A L S Sbjct: 261 VLKEMAMTGKTVICTIHQPS----SEVYSMFDKLLLMSEGRTAFLGS 303 >EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D protein. Length = 255 Score = 23.0 bits (47), Expect = 2.5 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -3 Query: 367 GRDRSFGEGCQGPHLHHYC 311 G++R EGC P +YC Sbjct: 66 GKNRGVTEGCDYPWRSNYC 84 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,025 Number of Sequences: 336 Number of extensions: 3257 Number of successful extensions: 13 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19155320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -