BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10i17f (641 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 22 3.7 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 22 3.7 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 22.2 bits (45), Expect = 3.7 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -2 Query: 640 PPSSIQPPTSRPY 602 PPS QPP PY Sbjct: 68 PPSGGQPPQGMPY 80 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 22.2 bits (45), Expect = 3.7 Identities = 15/58 (25%), Positives = 27/58 (46%) Frame = -3 Query: 366 SLHILFVRSVNQSFATSESRSQRQVAGKPVMILSPLNERRAQFSYLEQVAAHAGSTYH 193 S H F S +++ S S+ V +PV L+P ++ R + + + A S +H Sbjct: 137 SCHQGFSSSTWCNYSAYSSASRHHVDHQPVPYLTPADD-RGRVAAAAAMVAETASFHH 193 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,239 Number of Sequences: 336 Number of extensions: 3059 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16448590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -