BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10i16r (757 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein... 29 0.20 AY735443-1|AAU08018.1| 163|Anopheles gambiae bursicon protein. 26 1.1 AY735442-1|AAU08017.1| 163|Anopheles gambiae bursicon protein. 26 1.1 >CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein protein. Length = 415 Score = 28.7 bits (61), Expect = 0.20 Identities = 15/61 (24%), Positives = 27/61 (44%) Frame = -1 Query: 622 WSKFGDSASDKPGPNPATTNVAEDVFMQFITSKEESQRPDDGELDGLKPPSSNVIFKCRT 443 +SK + S +P P T + S + QRP +LD P+++ +++C Sbjct: 237 YSKKSTTVSYQPVPTGTPTRMLNGEPASQRPSSSQMQRPKVQQLDTAAAPTNHHLYRCPA 296 Query: 442 C 440 C Sbjct: 297 C 297 >AY735443-1|AAU08018.1| 163|Anopheles gambiae bursicon protein. Length = 163 Score = 26.2 bits (55), Expect = 1.1 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -3 Query: 182 CA*TVPCEGKKYWTLQRICLC 120 CA + G K W ++R C+C Sbjct: 67 CASYIQVSGSKIWQMERSCMC 87 >AY735442-1|AAU08017.1| 163|Anopheles gambiae bursicon protein. Length = 163 Score = 26.2 bits (55), Expect = 1.1 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -3 Query: 182 CA*TVPCEGKKYWTLQRICLC 120 CA + G K W ++R C+C Sbjct: 67 CASYIQVSGSKIWQMERSCMC 87 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 727,950 Number of Sequences: 2352 Number of extensions: 13387 Number of successful extensions: 29 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78170964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -