BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10i15r (752 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor p... 26 0.44 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 26 0.44 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 24 1.8 >AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor protein. Length = 139 Score = 25.8 bits (54), Expect = 0.44 Identities = 9/37 (24%), Positives = 16/37 (43%) Frame = +3 Query: 498 CVGCIFALLISKASWYAFCESSTTECLVSPVATSARY 608 C CI + S W +C S+ C+ + + R+ Sbjct: 35 CRNCIHPTVFSVLFWLGYCNSAINPCIYALFSKDFRF 71 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 25.8 bits (54), Expect = 0.44 Identities = 9/37 (24%), Positives = 16/37 (43%) Frame = +3 Query: 498 CVGCIFALLISKASWYAFCESSTTECLVSPVATSARY 608 C CI + S W +C S+ C+ + + R+ Sbjct: 483 CRNCIHPTVFSVLFWLGYCNSAINPCIYALFSKDFRF 519 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 23.8 bits (49), Expect = 1.8 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +1 Query: 109 RLLTFLQATARVGFGDDTAPDDVLEC 186 RL T LQAT G + P DV EC Sbjct: 131 RLNTRLQATLNCGLRLEKFPFDVQEC 156 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,278 Number of Sequences: 438 Number of extensions: 3769 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23632110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -