BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10i11r (534 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1705.02 |||human 4F5S homolog|Schizosaccharomyces pombe|chr ... 36 0.005 SPAC6F6.01 |||VIC sodium channel |Schizosaccharomyces pombe|chr ... 27 2.3 SPAC1142.01 ||SPAC17G6.18|DUF654 family protein|Schizosaccharomy... 27 2.3 SPBC543.05c |||inorganic anion exchanger |Schizosaccharomyces po... 26 3.1 SPAC3G6.07 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||... 25 7.1 SPCC11E10.08 |rik1||silencing protein Rik1|Schizosaccharomyces p... 25 9.4 SPBC16C6.06 |pep1|vps10|sorting receptor for CPY|Schizosaccharom... 25 9.4 SPCC290.04 |ams2|SPCC4F11.01|cell cycle regulated GATA-type tran... 25 9.4 >SPAC1705.02 |||human 4F5S homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 63 Score = 35.5 bits (78), Expect = 0.005 Identities = 17/31 (54%), Positives = 22/31 (70%) Frame = -1 Query: 327 MTRGNQRDLARAKNQKKQVEMQKKKNASEKT 235 M+RGNQRD+ RA+N KK + KKK A + T Sbjct: 1 MSRGNQRDVDRARNLKKS-QASKKKQAGDPT 30 >SPAC6F6.01 |||VIC sodium channel |Schizosaccharomyces pombe|chr 1|||Manual Length = 1854 Score = 26.6 bits (56), Expect = 2.3 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -3 Query: 529 RCVAFVLYTLIIAKSFFSNF 470 RC+ + YT IAK FSNF Sbjct: 621 RCILLIPYTRKIAKLLFSNF 640 >SPAC1142.01 ||SPAC17G6.18|DUF654 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 667 Score = 26.6 bits (56), Expect = 2.3 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -1 Query: 297 RAKNQKKQVEMQKKKNASEKTGLSLQ 220 +AKN+KK+ + QKKK + K L Q Sbjct: 95 KAKNKKKKKKQQKKKKVTGKRDLDNQ 120 >SPBC543.05c |||inorganic anion exchanger |Schizosaccharomyces pombe|chr 2|||Manual Length = 517 Score = 26.2 bits (55), Expect = 3.1 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -3 Query: 508 YTLIIAKSFFSNFTPIGEMEGGALS*VSTGLAYRPAFT 395 Y L+ + FFS F IG+M +L+ + T A+ P + Sbjct: 222 YGLVASIIFFSGFQHIGKMREVSLAKLPTTKAFEPTLS 259 >SPAC3G6.07 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 125 Score = 25.0 bits (52), Expect = 7.1 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +3 Query: 321 ESF*LDNFTKEKFTFVATYNYFKNTVK 401 ESF D+F K+T V Y +++ VK Sbjct: 90 ESFVGDDFVMPKYTLVLPYRVYRDHVK 116 >SPCC11E10.08 |rik1||silencing protein Rik1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1040 Score = 24.6 bits (51), Expect = 9.4 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +3 Query: 342 FTKEKFTFVATYNYFKNTVKAGRYASPV 425 F +KF VA Y + +N VKA Y V Sbjct: 854 FDGQKFIVVARYLFGENIVKAALYEGTV 881 >SPBC16C6.06 |pep1|vps10|sorting receptor for CPY|Schizosaccharomyces pombe|chr 2|||Manual Length = 1466 Score = 24.6 bits (51), Expect = 9.4 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +3 Query: 336 DNFTKEKFTFVATYNYFKNTV 398 D F+KE+F+ V + Y KN+V Sbjct: 748 DKFSKEEFSSVLPHAYNKNSV 768 >SPCC290.04 |ams2|SPCC4F11.01|cell cycle regulated GATA-type transcription factor Ams2|Schizosaccharomyces pombe|chr 3|||Manual Length = 697 Score = 24.6 bits (51), Expect = 9.4 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 303 LARAKNQKKQVEMQKKKNASEKTGLSLQERK 211 +AR + +KK ++ K E+ LSLQE K Sbjct: 316 IARGRIEKKFTNVRGKNRIEEQLTLSLQEGK 346 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,817,030 Number of Sequences: 5004 Number of extensions: 30834 Number of successful extensions: 93 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 93 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 93 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 220420454 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -