BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10i07r (773 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-9|CAJ14150.1| 872|Anopheles gambiae putative calcium/c... 25 2.6 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 25 3.4 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 24 4.5 CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein ... 23 7.9 >CR954256-9|CAJ14150.1| 872|Anopheles gambiae putative calcium/calmodulin-dependentprotein kinase, CAKI protein. Length = 872 Score = 25.0 bits (52), Expect = 2.6 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = -3 Query: 633 MLADPSGNFIKALDLGTNLPPLGGFRSKRFSMVIVDSKVQDLNVEP 496 M+AD S N + L+ GT+ + G + + + D K+ L+VEP Sbjct: 749 MMADISAN--EYLEYGTHEDAMYGTKLETIRRIHADGKMAILDVEP 792 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 24.6 bits (51), Expect = 3.4 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -3 Query: 360 CSNFSQLIFFSRRLRS*VN*GKGCIEC 280 C+ +S FF R L + G CI+C Sbjct: 344 CNGYSTKCFFDRHLYNLTGHGGHCIDC 370 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 24.2 bits (50), Expect = 4.5 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +3 Query: 156 INSVALYVKLLS*QPKQINNMKTRINADFPT 248 + V LL QP+Q+ + T + DFPT Sbjct: 586 LGQVTYKTSLLHLQPRQMKLVITELRDDFPT 616 >CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein protein. Length = 615 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 486 QCHRAPHSDLGPCC 527 QCH+A H D+G C Sbjct: 341 QCHKALHLDIGLRC 354 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 784,571 Number of Sequences: 2352 Number of extensions: 15734 Number of successful extensions: 15 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80665782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -