BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10i07r (773 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 23 3.2 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 23 3.2 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 23 3.2 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 23 3.2 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 23 4.2 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 23.0 bits (47), Expect = 3.2 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 668 QAAITYGSLTDTHTISATPSDFSLSAF 748 Q AITY D T+ +PS SL+A+ Sbjct: 211 QTAITYVWKNDEGTLRKSPSLTSLNAY 237 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 23.0 bits (47), Expect = 3.2 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 668 QAAITYGSLTDTHTISATPSDFSLSAF 748 Q AITY D T+ +PS SL+A+ Sbjct: 211 QTAITYVWKNDEGTLRKSPSLTSLNAY 237 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 23.0 bits (47), Expect = 3.2 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 668 QAAITYGSLTDTHTISATPSDFSLSAF 748 Q AITY D T+ +PS SL+A+ Sbjct: 262 QTAITYVWKNDEGTLRKSPSLTSLNAY 288 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 23.0 bits (47), Expect = 3.2 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 668 QAAITYGSLTDTHTISATPSDFSLSAF 748 Q AITY D T+ +PS SL+A+ Sbjct: 211 QTAITYVWKNDEGTLRKSPSLTSLNAY 237 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 22.6 bits (46), Expect = 4.2 Identities = 8/31 (25%), Positives = 19/31 (61%) Frame = -1 Query: 626 PIPAATSSRLWTWAPICRRSEVSAPKGSRWS 534 P+P A + + + + C++ + +A GSR++ Sbjct: 564 PLPLARTPSVMSASSTCKKDKKNAGSGSRFT 594 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 206,786 Number of Sequences: 438 Number of extensions: 4661 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24275400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -