BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10i07f (621 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-9|CAJ14150.1| 872|Anopheles gambiae putative calcium/c... 25 1.9 AB107248-1|BAE72063.1| 278|Anopheles gambiae Bcl-2 family prote... 25 2.6 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 23 5.9 DQ974165-1|ABJ52805.1| 482|Anopheles gambiae serpin 5 protein. 23 5.9 CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein ... 23 5.9 >CR954256-9|CAJ14150.1| 872|Anopheles gambiae putative calcium/calmodulin-dependentprotein kinase, CAKI protein. Length = 872 Score = 25.0 bits (52), Expect = 1.9 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = +1 Query: 460 MLADPSGNFIKALDLGTNLPPLGGFRSKRFSMVIVDSKVQDLNVEP 597 M+AD S N + L+ GT+ + G + + + D K+ L+VEP Sbjct: 749 MMADISAN--EYLEYGTHEDAMYGTKLETIRRIHADGKMAILDVEP 792 >AB107248-1|BAE72063.1| 278|Anopheles gambiae Bcl-2 family protein Anob-1 protein. Length = 278 Score = 24.6 bits (51), Expect = 2.6 Identities = 12/42 (28%), Positives = 20/42 (47%) Frame = +1 Query: 256 LTAGKKVVLFAVPGAFTPGCSKTHLPGYVQNADKLKSDGVAE 381 +T GK + LFA+ G C + Y+Q + +D + E Sbjct: 173 ITWGKVISLFAIAGGLAVDCVRQDHADYLQQLIEGTADVIEE 214 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 23.4 bits (48), Expect = 5.9 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 3/37 (8%) Frame = -2 Query: 335 PGKCVLEHP---GVKAPGTANNTTFFPAVNSQIFTLL 234 PGKC+ HP +K GTA + F ++ S I T + Sbjct: 1213 PGKCISYHPEEIEIKQCGTA-TSLFHASLYSTIATFI 1248 >DQ974165-1|ABJ52805.1| 482|Anopheles gambiae serpin 5 protein. Length = 482 Score = 23.4 bits (48), Expect = 5.9 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -2 Query: 230 GESSNKSAAGS*SPTLIGAMLNCEM*SARADAR 132 G SSN S SP IG+M+ + +A D R Sbjct: 69 GSSSNSSKTELFSPVSIGSMMLLLLRAANRDTR 101 >CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein protein. Length = 615 Score = 23.4 bits (48), Expect = 5.9 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 607 QCHRAPHSDLGPCC 566 QCH+A H D+G C Sbjct: 341 QCHKALHLDIGLRC 354 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 681,193 Number of Sequences: 2352 Number of extensions: 14210 Number of successful extensions: 24 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 60214320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -