BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10i07f (621 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g65980.1 68414.m07486 peroxiredoxin type 2, putative strong s... 136 1e-32 At1g60740.1 68414.m06838 peroxiredoxin type 2, putative strong s... 134 4e-32 At1g65970.1 68414.m07485 peroxiredoxin type 2, putative strong s... 134 6e-32 At3g52960.1 68416.m05838 peroxiredoxin type 2, putative similar ... 122 1e-28 At1g65990.1 68414.m07488 type 2 peroxiredoxin-related / thiol sp... 108 3e-24 At3g06050.1 68416.m00692 alkyl hydroperoxide reductase/thiol spe... 99 1e-21 At1g48130.1 68414.m05371 peroxiredoxin (PER1) / rehydrin, putati... 45 4e-05 At5g46250.2 68418.m05694 RNA recognition motif (RRM)-containing ... 34 0.087 At5g46250.1 68418.m05693 RNA recognition motif (RRM)-containing ... 34 0.087 At3g26060.1 68416.m03245 peroxiredoxin Q, putative similar to pe... 33 0.15 At3g02890.1 68416.m00284 PHD finger protein-related contains low... 31 0.81 At2g33240.1 68415.m04072 myosin, putative similar to myosin (GI:... 29 1.9 At5g07360.1 68418.m00840 amidase family protein low similarity t... 29 3.3 At1g55320.1 68414.m06319 acyl-activating enzyme 18 (AAE18) nearl... 29 3.3 >At1g65980.1 68414.m07486 peroxiredoxin type 2, putative strong similarity to type 2 peroxiredoxin [Brassica rapa subsp. pekinensis] GI:4928472; contains Pfam profile: PF00578 AhpC/TSA (alkyl hydroperoxide reductase and thiol-specific antioxidant) family Length = 162 Score = 136 bits (328), Expect = 1e-32 Identities = 69/148 (46%), Positives = 93/148 (62%), Gaps = 4/148 (2%) Frame = +1 Query: 172 MAPIKVGDQLPAADLF---EDSPANKVNICELTAGKKVVLFAVPGAFTPGCSKTHLPGYV 342 MAPI VGD +P + E+ ++ L AGKKV+LF VPGAFTP CS H+PG++ Sbjct: 1 MAPIAVGDVVPDGTISFFDENDQLQTASVHSLAAGKKVILFGVPGAFTPTCSMKHVPGFI 60 Query: 343 QNADKLKSDGVAEIVCVSVNDPYVMAAWGAQHNTKGKVRMLADPSGNFIKALDLGTNLPP 522 + A++LKS GV EI+C SVNDP+VM AWG + V+ +AD SG + L L +L Sbjct: 61 EKAEELKSKGVDEIICFSVNDPFVMKAWGKTYPENKHVKFVADGSGEYTHLLGLELDLKD 120 Query: 523 LG-GFRSKRFSMVIVDSKVQDLNVEPDG 603 G G RS+RF++++ D KV NVE G Sbjct: 121 KGLGVRSRRFALLLDDLKVTVANVESGG 148 >At1g60740.1 68414.m06838 peroxiredoxin type 2, putative strong similarity to type 2 peroxiredoxin [Brassica rapa subsp. pekinensis] GI:4928472; contains Pfam profile: PF00578 AhpC/TSA (alkyl hydroperoxide reductase and thiol-specific antioxidant) family Length = 162 Score = 134 bits (324), Expect = 4e-32 Identities = 67/148 (45%), Positives = 94/148 (63%), Gaps = 4/148 (2%) Frame = +1 Query: 172 MAPIKVGDQLPAADLF---EDSPANKVNICELTAGKKVVLFAVPGAFTPGCSKTHLPGYV 342 MAPI VGD +P + E+ V++ + AGKKV+LF VPGAFTP CS +H+PG++ Sbjct: 1 MAPITVGDVVPDGTISFFDENDQLQTVSVHSIAAGKKVILFGVPGAFTPTCSMSHVPGFI 60 Query: 343 QNADKLKSDGVAEIVCVSVNDPYVMAAWGAQHNTKGKVRMLADPSGNFIKALDLGTNLPP 522 A++LKS G+ EI+C SVNDP+VM AWG + V+ +AD SG + L L +L Sbjct: 61 GKAEELKSKGIDEIICFSVNDPFVMKAWGKTYQENKHVKFVADGSGEYTHLLGLELDLKD 120 Query: 523 LG-GFRSKRFSMVIVDSKVQDLNVEPDG 603 G G RS+RF++++ + KV NVE G Sbjct: 121 KGLGIRSRRFALLLDNLKVTVANVENGG 148 >At1g65970.1 68414.m07485 peroxiredoxin type 2, putative strong similarity to type 2 peroxiredoxin [Brassica rapa subsp. pekinensis] GI:4928472; contains Pfam profile: PF00578 AhpC/TSA (alkyl hydroperoxide reductase and thiol-specific antioxidant) family Length = 162 Score = 134 bits (323), Expect = 6e-32 Identities = 67/148 (45%), Positives = 94/148 (63%), Gaps = 4/148 (2%) Frame = +1 Query: 172 MAPIKVGDQLPAADLF---EDSPANKVNICELTAGKKVVLFAVPGAFTPGCSKTHLPGYV 342 MAPI VGD +P + E+ V++ + AGKKV+LF VPGAFTP CS +H+PG++ Sbjct: 1 MAPITVGDVVPDGTISFFDENDQLQTVSVHSIAAGKKVILFGVPGAFTPTCSMSHVPGFI 60 Query: 343 QNADKLKSDGVAEIVCVSVNDPYVMAAWGAQHNTKGKVRMLADPSGNFIKALDLGTNLPP 522 A++LKS G+ EI+C SVNDP+VM AWG + V+ +AD SG + L L +L Sbjct: 61 GKAEELKSKGIDEIICFSVNDPFVMKAWGKTYPENKHVKFVADGSGEYTHLLGLELDLKD 120 Query: 523 LG-GFRSKRFSMVIVDSKVQDLNVEPDG 603 G G RS+RF++++ + KV NVE G Sbjct: 121 KGLGIRSRRFALLLDNLKVTVANVESGG 148 >At3g52960.1 68416.m05838 peroxiredoxin type 2, putative similar to type 2 peroxiredoxin [Brassica rapa subsp. pekinensis] GI:4928472; contains Pfam profile: PF00578 AhpC/TSA (alkyl hydroperoxide reductase and thiol-specific antioxidant) family Length = 234 Score = 122 bits (295), Expect = 1e-28 Identities = 70/167 (41%), Positives = 99/167 (59%), Gaps = 8/167 (4%) Frame = +1 Query: 127 TNRASARALHISQLSM-APIKVGDQLPAADLFEDSPAN----KVNICELTAGKKVVLFAV 291 TN ASA + + A I VGD+LP + L P+ V + LTAGKK +LFAV Sbjct: 54 TNSASATTRSFATTPVTASISVGDKLPDSTLSYLDPSTGDVKTVTVSSLTAGKKTILFAV 113 Query: 292 PGAFTPGCSKTHLPGYVQNADKLKSDGVAEIVCVSVNDPYVMAAWGAQHNTKGKVRMLAD 471 PGAFTP CS+ H+PG+V A +L+S G+ I C+SVND +VM AW +V +L+D Sbjct: 114 PGAFTPTCSQKHVPGFVSKAGELRSKGIDVIACISVNDAFVMEAWRKDLGINDEVMLLSD 173 Query: 472 PSGNFIKALDLGTNL--PPLG-GFRSKRFSMVIVDSKVQDLNVEPDG 603 +G F L + +L P+G G RS+R++++ D V+ LN+E G Sbjct: 174 GNGEFTGKLGVELDLRDKPVGLGVRSRRYAILADDGVVKVLNLEEGG 220 >At1g65990.1 68414.m07488 type 2 peroxiredoxin-related / thiol specific antioxidant / mal allergen family protein similar to type 2 peroxiredoxin [Brassica rapa subsp. pekinensis] GI:4928472; contains Pfam profiles PF00646: F-box domain, PF00578: AhpC/TSA family Length = 553 Score = 108 bits (259), Expect = 3e-24 Identities = 61/154 (39%), Positives = 94/154 (61%), Gaps = 4/154 (2%) Frame = +1 Query: 172 MAPIKVGDQLPAADLF---EDSPANKVNICELTAGKKVVLFAVPGAFTPGCSKTHLPGYV 342 MAPI VGD +P + +D V++ L AGKKV+LF VPGAF P CS H+ G++ Sbjct: 1 MAPIDVGDFVPDGSISFFDDDDQLQTVSVHSLAAGKKVILFGVPGAFPPTCSMNHVNGFI 60 Query: 343 QNADKLKSDGVAEIVCVSVNDPYVMAAWGAQHNTKGKVRMLADPSGNFIKALDLGTNLPP 522 + A++LKS+GV EI+C+S +DP+++ A + V+ + D SG +I+ L L + Sbjct: 61 EKAEELKSNGVDEIICLSGDDPFMITACSENKH----VKFVEDGSGEYIQLLGLELEVKD 116 Query: 523 LG-GFRSKRFSMVIVDSKVQDLNVEPDGTGLSCS 621 G G RS+ F++++ + KV +NV G+G CS Sbjct: 117 KGLGVRSRGFALLLDNLKVIVVNV---GSGGDCS 147 >At3g06050.1 68416.m00692 alkyl hydroperoxide reductase/thiol specific antioxidant (AhpC/TSA)/mal allergen family protein identical to SP|Q9M7T0 Putative peroxiredoxin, mitochondrial precursor {Arabidopsis thaliana}; similar to thioredoxin peroxidase [Capsicum annuum] GI:18654477; contains Pfam profile: PF00578 AhpC/TSA (alkyl hydroperoxide reductase and thiol-specific antioxidant) family Length = 201 Score = 99 bits (238), Expect = 1e-21 Identities = 47/117 (40%), Positives = 71/117 (60%), Gaps = 1/117 (0%) Frame = +1 Query: 247 ICELTAGKKVVLFAVPGAFTPGCSKTHLPGYVQNADKLKSDGVAEIVCVSVNDPYVMAAW 426 + ++ GKKVV+F +PGA+T CS+ H+P Y + DK K+ G+ ++CVSVNDP+ + W Sbjct: 67 LSDIFKGKKVVIFGLPGAYTGVCSQQHVPSYKSHIDKFKAKGIDSVICVSVNDPFAINGW 126 Query: 427 GAQHNTKGKVRMLADPSGNFIKALDLGTNL-PPLGGFRSKRFSMVIVDSKVQDLNVE 594 + K + D G F K+L L +L L G RS+R+S + D KV+ +NVE Sbjct: 127 AEKLGAKDAIEFYGDFDGKFHKSLGLDKDLSAALLGPRSERWSAYVEDGKVKAVNVE 183 >At1g48130.1 68414.m05371 peroxiredoxin (PER1) / rehydrin, putative identical to peroxiredoxin (Rehydrin homolog) [Arabidopsis thaliana] SWISS-PROT:O04005; contains Pfam profile: PF00578 AhpC/TSA (alkyl hydroperoxide reductase and thiol-specific antioxidant) family Length = 216 Score = 45.2 bits (102), Expect = 4e-05 Identities = 40/151 (26%), Positives = 71/151 (47%), Gaps = 5/151 (3%) Frame = +1 Query: 172 MAPIKVGDQLPAADLFEDSPANKVNICELTAGKKVVLFAVPGAFTPGCSKTHLPGYVQNA 351 M I +GD +P ++ ++ +K + + A VLF+ PG FTP C+ T L + A Sbjct: 1 MPGITLGDTVPNLEV--ETTHDKFKLHDYFANSWTVLFSHPGDFTPVCT-TELGAMAKYA 57 Query: 352 DKLKSDGVAEIVCVSVNDPYVMAAW-----GAQHNTKGKVRMLADPSGNFIKALDLGTNL 516 + GV +++ +S +D W H +K ++ADP+ I L++ + Sbjct: 58 HEFDKRGV-KLLGLSCDDVQSHKDWIKDIEAFNHGSKVNYPIIADPNKEIIPQLNM---I 113 Query: 517 PPLGGFRSKRFSMVIVDSKVQDLNVEPDGTG 609 P+ S+ +V DSK++ + P TG Sbjct: 114 DPIENGPSRALHIVGPDSKIKLSFLYPSTTG 144 >At5g46250.2 68418.m05694 RNA recognition motif (RRM)-containing protein contains similarity to RNA-binding protein; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 420 Score = 33.9 bits (74), Expect = 0.087 Identities = 20/62 (32%), Positives = 30/62 (48%) Frame = +3 Query: 414 DGGLGSSAQH*RKGAYASRSQRQLHQGSGPGHQSAAARRFPLQKVLDGHR*QQGPRSECG 593 DGG ++ KG + +RQ HQG G GH +A++ P ++ + GPR G Sbjct: 338 DGGNHQKDKNGNKGRVVGQGRRQNHQG-GNGHGTASSSSHPNYHPVEVSKRPPGPRMPDG 396 Query: 594 AR 599 R Sbjct: 397 TR 398 >At5g46250.1 68418.m05693 RNA recognition motif (RRM)-containing protein contains similarity to RNA-binding protein; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 422 Score = 33.9 bits (74), Expect = 0.087 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Frame = +3 Query: 414 DGGLGSSAQH*RKGAYASRSQRQLHQ-GSGPGHQSAAARRFPLQKVLDGHR*QQGPRSEC 590 DGG ++ KG + +RQ HQ G+G GH +A++ P ++ + GPR Sbjct: 338 DGGNHQKDKNGNKGRVVGQGRRQNHQGGNGIGHGTASSSSHPNYHPVEVSKRPPGPRMPD 397 Query: 591 GAR 599 G R Sbjct: 398 GTR 400 >At3g26060.1 68416.m03245 peroxiredoxin Q, putative similar to peroxiredoxin Q [Sedum lineare] GI:6899842; contains Pfam profile: PF00578 AhpC/TSA (alkyl hydroperoxide reductase and thiol-specific antioxidant) family Length = 216 Score = 33.1 bits (72), Expect = 0.15 Identities = 31/109 (28%), Positives = 53/109 (48%) Frame = +1 Query: 166 LSMAPIKVGDQLPAADLFEDSPANKVNICELTAGKKVVLFAVPGAFTPGCSKTHLPGYVQ 345 L A + G P L +D V++ + GK VVL+ P TPGC+K + Sbjct: 64 LIFAKVNKGQAAPDFTL-KDQNGKPVSLKKYK-GKPVVLYFYPADETPGCTK-QACAFRD 120 Query: 346 NADKLKSDGVAEIVCVSVNDPYVMAAWGAQHNTKGKVRMLADPSGNFIK 492 + +K K G AE++ +S +D A+ +++ K +L+D GN ++ Sbjct: 121 SYEKFKKAG-AEVIGISGDDSASHKAFASKY--KLPYTLLSD-EGNKVR 165 >At3g02890.1 68416.m00284 PHD finger protein-related contains low similarity to PHD-finger domain proteins Length = 963 Score = 30.7 bits (66), Expect = 0.81 Identities = 21/75 (28%), Positives = 39/75 (52%) Frame = -2 Query: 497 RALMKLPLGSASIRTFPLVLC*APQAAITYGSLTDTHTISATPSDFSLSAFCTYPGKCVL 318 R +++ G+ ++ + P C A + GS +D S S L++ C++ G +L Sbjct: 4 RGRLEIQSGTCNVCSAPCSSCMHHNAEFS-GSKSDES--SDENSHGVLASQCSFNGDNLL 60 Query: 317 EHPGVKAPGTANNTT 273 GV APG+++NT+ Sbjct: 61 RSSGVNAPGSSHNTS 75 >At2g33240.1 68415.m04072 myosin, putative similar to myosin (GI:433663) [Arabidopsis thaliana]; myosin my5A (SP:Q02440) {Gallus gallus} Length = 1770 Score = 29.5 bits (63), Expect = 1.9 Identities = 20/72 (27%), Positives = 31/72 (43%), Gaps = 1/72 (1%) Frame = +1 Query: 388 CVSVNDPYVMAAWGAQHNTKGKVRMLADPSGNFIKALDLGTNL-PPLGGFRSKRFSMVIV 564 C + +V ++W NT+ + +L + I DL TNL P L + R + Sbjct: 1636 CSQATEDFVGSSWDELKNTRQALVLLVTEQKSTITYDDLTTNLCPALSTQQLYRICTLCK 1695 Query: 565 DSKVQDLNVEPD 600 +D NV PD Sbjct: 1696 IDDHEDQNVSPD 1707 >At5g07360.1 68418.m00840 amidase family protein low similarity to enantiomerase-selective amidase [Rhodococcus sp.] GI:152052; contains Pfam profile PF01425: Amidase Length = 659 Score = 28.7 bits (61), Expect = 3.3 Identities = 20/77 (25%), Positives = 30/77 (38%), Gaps = 2/77 (2%) Frame = -2 Query: 524 SGGRLVPRSRALMKLPLGS--ASIRTFPLVLC*APQAAITYGSLTDTHTISATPSDFSLS 351 S G S ++ +GS A T+P C T+GS+ T +S + S L Sbjct: 349 SAGPAASTSAGMVPFAIGSETAGSMTYPAARCGITALRPTFGSVGRTGVMSISESLDKLG 408 Query: 350 AFCTYPGKCVLEHPGVK 300 FC C + +K Sbjct: 409 PFCRTAADCAVILDAIK 425 >At1g55320.1 68414.m06319 acyl-activating enzyme 18 (AAE18) nearly identical to acyl-activating enzyme 18 [Arabidopsis thaliana] GI:29893268; similar to acetyl-CoA synthetase [SP|P27095] from Methanothrix soehngenii; contains Pfam AMP-binding enzyme domain PF00501l; identical to cDNA acyl-activating enzyme 18 (At1g55320) GI: 29893267 Length = 725 Score = 28.7 bits (61), Expect = 3.3 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 217 FEDSPANKVNICELTAGKKVVLFAVPGAFTPG 312 F+DSP N++ I EL +V A+ G+F G Sbjct: 199 FDDSPVNRMTIKELREQVMLVANAISGSFEKG 230 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,905,733 Number of Sequences: 28952 Number of extensions: 310807 Number of successful extensions: 862 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 799 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 854 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1255974912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -