BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10i06f (426 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g34555.1 68417.m04910 40S ribosomal protein S25, putative 93 7e-20 At4g39200.1 68417.m05550 40S ribosomal protein S25 (RPS25E) ribo... 91 2e-19 At2g21580.1 68415.m02567 40S ribosomal protein S25 (RPS25B) 91 2e-19 At2g16360.1 68415.m01872 40S ribosomal protein S25 (RPS25A) 85 3e-17 At4g27630.1 68417.m03971 expressed protein 31 0.43 At5g20320.1 68418.m02418 DEAD/DEAH box helicase, putative simila... 29 1.7 At1g14500.1 68414.m01719 ankyrin repeat family protein contains ... 29 1.7 At2g17250.1 68415.m01992 expressed protein weak similarity to Ri... 28 3.0 At5g65970.1 68418.m08305 seven transmembrane MLO family protein ... 27 4.0 At5g16810.1 68418.m01969 expressed protein 27 5.3 At2g23170.1 68415.m02768 auxin-responsive GH3 family protein sim... 27 7.0 At1g24706.1 68414.m03104 expressed protein 27 7.0 At5g64950.1 68418.m08170 mitochondrial transcription termination... 26 9.3 At1g48180.1 68414.m05378 expressed protein ; expression supporte... 26 9.3 >At4g34555.1 68417.m04910 40S ribosomal protein S25, putative Length = 108 Score = 93.1 bits (221), Expect = 7e-20 Identities = 42/72 (58%), Positives = 55/72 (76%) Frame = +3 Query: 144 LNNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIELREKGLIKQVVQH 323 +NN VLFD+ TY+KL E P++KLITP+++S+RL++ GSLARRA+ EL KG I+ V H Sbjct: 37 VNNMVLFDQATYDKLLSEAPKFKLITPSILSDRLRINGSLARRAIRELMAKGTIRMVSAH 96 Query: 324 HGQVIYTRATKG 359 Q IYTRAT G Sbjct: 97 SSQQIYTRATHG 108 >At4g39200.1 68417.m05550 40S ribosomal protein S25 (RPS25E) ribosomal protein S25, Lycopersicon esculentum, PIR2:S40089 Length = 108 Score = 91.5 bits (217), Expect = 2e-19 Identities = 40/70 (57%), Positives = 55/70 (78%) Frame = +3 Query: 144 LNNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIELREKGLIKQVVQH 323 +NN VLFD+ TY+KL E P++KLITP+++S+R+++ GSLARRA+ EL KG+I+ V H Sbjct: 37 VNNMVLFDQATYDKLLTEAPKFKLITPSILSDRMRINGSLARRAIRELMAKGVIRMVAAH 96 Query: 324 HGQVIYTRAT 353 Q IYTRAT Sbjct: 97 SSQQIYTRAT 106 >At2g21580.1 68415.m02567 40S ribosomal protein S25 (RPS25B) Length = 108 Score = 91.5 bits (217), Expect = 2e-19 Identities = 41/70 (58%), Positives = 55/70 (78%) Frame = +3 Query: 144 LNNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIELREKGLIKQVVQH 323 +NN VLFD+ TY+KL E P++KLITP+++S+R+++ GSLARRA+ EL KGLI+ V H Sbjct: 37 VNNMVLFDQGTYDKLLTEAPKFKLITPSILSDRMRINGSLARRAIRELMAKGLIRMVSAH 96 Query: 324 HGQVIYTRAT 353 Q IYTRAT Sbjct: 97 SSQQIYTRAT 106 >At2g16360.1 68415.m01872 40S ribosomal protein S25 (RPS25A) Length = 125 Score = 84.6 bits (200), Expect = 3e-17 Identities = 38/70 (54%), Positives = 53/70 (75%) Frame = +3 Query: 144 LNNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIELREKGLIKQVVQH 323 +NN VLFD+ TY+KL E P++KLITP+++S+RL++ GSLAR+A+ +L KG I+ V H Sbjct: 53 VNNMVLFDQATYDKLMSEAPKFKLITPSILSDRLRINGSLARKAIRDLMVKGTIRMVSTH 112 Query: 324 HGQVIYTRAT 353 Q I TRAT Sbjct: 113 SSQQINTRAT 122 >At4g27630.1 68417.m03971 expressed protein Length = 348 Score = 30.7 bits (66), Expect = 0.43 Identities = 18/57 (31%), Positives = 26/57 (45%) Frame = -3 Query: 337 ITCPWCWTTCLMRPFSLSSMSALLAREPRTFNLSDTTAGVISLYCGTSLYSFSYVGL 167 I P CWTT L PF L ++ R + T V+S + +L +SY+ L Sbjct: 4 ILSPTCWTTLLKHPFILKGFFSMPQLVSRIGVIGVTLMAVLSGFGAVNL-PYSYISL 59 >At5g20320.1 68418.m02418 DEAD/DEAH box helicase, putative similar to CAF protein [Arabidopsis thaliana] GI:6102610; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain, PF03368: Domain of unknown function, PF00636: RNase3 domain, PF00035: Double-stranded RNA binding motif Length = 1676 Score = 28.7 bits (61), Expect = 1.7 Identities = 24/66 (36%), Positives = 30/66 (45%), Gaps = 1/66 (1%) Frame = -2 Query: 323 VLDYLFDETFFPKFDECSSRQGTSDL*PFRYDSRCD*LVLWDF-LVQFLICGFIKQHLVV 147 VLDYL FF F + Q T DL ++ V F L +FL C I H V+ Sbjct: 1310 VLDYLMTSYFFTVFPKLKPGQLT-DLRSLSVNNEALANVAVSFSLKRFLFCESIYLHEVI 1368 Query: 146 QLVTNF 129 + TNF Sbjct: 1369 EDYTNF 1374 >At1g14500.1 68414.m01719 ankyrin repeat family protein contains Pfam domain, PF00023: Ankyrin repeat Length = 436 Score = 28.7 bits (61), Expect = 1.7 Identities = 12/49 (24%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = -3 Query: 208 YCGTSLYSFSYVGLSN--NTWLFNLSRTFPLDHFFFLALPPPDPSFFFC 68 +C LY+F + + + TW F + + + + +A+ P+P F C Sbjct: 342 FCCALLYTFCLLPIGSLFTTWFFWIGASLGVSYALAMAIISPNPLLFLC 390 >At2g17250.1 68415.m01992 expressed protein weak similarity to Ribosome biogenesis protein MAK21 (Swiss-Prot:Q12176) [Saccharomyces cerevisiae] Length = 577 Score = 27.9 bits (59), Expect = 3.0 Identities = 13/47 (27%), Positives = 29/47 (61%) Frame = +3 Query: 147 NNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIEL 287 +++ + +KPT +K E L++PA +S+R+K++ + A + + L Sbjct: 245 SDESISEKPTDKKKKTEKGDSTLLSPATISKRMKLKFTKAWISFLRL 291 >At5g65970.1 68418.m08305 seven transmembrane MLO family protein / MLO-like protein 10 (MLO10) identical to membrane protein Mlo10 [Arabidopsis thaliana] gi|14091590|gb|AAK53803; similar to MLO protein SWISS-PROT:P93766, NCBI_gi:1877221 [Hordeum vulgare][Barley] Length = 569 Score = 27.5 bits (58), Expect = 4.0 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = -3 Query: 331 CPWCWTTCLMRPFSLSSMS-ALLAREPRTFNLSDTTAGVISLYC 203 C WCWTT L L+ + A A + LS T ++L C Sbjct: 5 CFWCWTTLLFCSQLLTGFARASSAGGAKEKGLSQTPTWAVALVC 48 >At5g16810.1 68418.m01969 expressed protein Length = 418 Score = 27.1 bits (57), Expect = 5.3 Identities = 11/41 (26%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +2 Query: 11 FKDAAQEGREGFGQTAS-KNTEEEGRIRWRQSQEEEVVQRK 130 F+D ++ + QTAS K T + W ++E++++R+ Sbjct: 181 FRDGGKDSAADYAQTASEKTTRARSQGVWNPYEKEQMIKRR 221 >At2g23170.1 68415.m02768 auxin-responsive GH3 family protein similar to auxin-responsive GH3 product [Glycine max] GI:18591; contains Pfam profile PF03321: GH3 auxin-responsive promoter Length = 595 Score = 26.6 bits (56), Expect = 7.0 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -2 Query: 182 LICGFIKQHLVVQLVTNFSFGPLLLLGFAAT 90 ++CG + +H V++L F+ G L +GF T Sbjct: 213 MLCGLLMRHEVLRLGAVFASGLLRAIGFLQT 243 >At1g24706.1 68414.m03104 expressed protein Length = 1781 Score = 26.6 bits (56), Expect = 7.0 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -3 Query: 145 NLSRTFPLDHFFFLALPPPDP 83 +L ++ P DHF LPPP P Sbjct: 1562 SLEKSHPDDHFHSQGLPPPPP 1582 >At5g64950.1 68418.m08170 mitochondrial transcription termination factor-related / mTERF-related contains Pfam profile PF02536: mTERF Length = 391 Score = 26.2 bits (55), Expect = 9.3 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = -3 Query: 286 SSMSALLAREPRTFNLSD 233 S +++LL R+PR FNLS+ Sbjct: 196 SQLASLLRRQPRIFNLSE 213 >At1g48180.1 68414.m05378 expressed protein ; expression supported by MPSS Length = 239 Score = 26.2 bits (55), Expect = 9.3 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -3 Query: 241 LSDTTAGVISLYCGTSLYSFSYVGL 167 L + + +YCGTS SYVGL Sbjct: 149 LQQDASAITGIYCGTSGEPASYVGL 173 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,125,042 Number of Sequences: 28952 Number of extensions: 190744 Number of successful extensions: 633 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 620 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 633 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 665183504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -