BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10i02r (747 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 23 3.4 AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 22 4.5 AM292346-1|CAL23158.2| 314|Tribolium castaneum gustatory recept... 22 4.5 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 21 7.9 AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory recept... 21 7.9 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = +1 Query: 313 QFLNEFTRLVHLQHYVTTTNKFTIDKDLRY 402 + + RL+H + +T FTID L + Sbjct: 278 EVIGNILRLMHRRFEITALRLFTIDNKLLF 307 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 22.2 bits (45), Expect = 4.5 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -3 Query: 235 SQVLCI*FCSFLFVLE 188 SQV+ I FC+F+ VL+ Sbjct: 177 SQVMLIQFCAFVVVLK 192 >AM292346-1|CAL23158.2| 314|Tribolium castaneum gustatory receptor candidate 25 protein. Length = 314 Score = 22.2 bits (45), Expect = 4.5 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -3 Query: 235 SQVLCI*FCSFLFVLE 188 SQV+ I FC+F+ VL+ Sbjct: 2 SQVMLIQFCAFVVVLK 17 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 21.4 bits (43), Expect = 7.9 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 42 IYYLCCFNNFVVIV 1 +Y CC NNF V + Sbjct: 158 VYVYCCDNNFNVFL 171 >AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory receptor candidate 50 protein. Length = 350 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = -3 Query: 214 FCSFLFVLEIIVLIHFKWWYCIET 143 F +FLFVL + +++YC ++ Sbjct: 234 FQNFLFVLSTFSICITQFYYCYDS 257 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,599 Number of Sequences: 336 Number of extensions: 3145 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19923648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -