BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10i02r (747 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C prot... 25 0.57 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 22 5.3 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 22 5.3 AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor p... 22 7.0 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 22 7.0 >AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C protein. Length = 149 Score = 25.4 bits (53), Expect = 0.57 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = -1 Query: 420 YSNWPTIPQVFINGEFVGGCDIMLQMHQSGELIE 319 +S + T+ +++ E+V G D+M Q+ Q G+ E Sbjct: 51 HSCFQTMDRLYFVMEYVNGGDLMYQIQQCGKFKE 84 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -1 Query: 702 EYICVNMNTLVRRSFQAFNTTLKISC 625 EY C+ ++ L +R F + + I C Sbjct: 227 EYSCLKVDLLFKREFSYYLIQIYIPC 252 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -1 Query: 702 EYICVNMNTLVRRSFQAFNTTLKISC 625 EY C+ ++ L +R F + + I C Sbjct: 227 EYSCLKVDLLFKREFSYYLIQIYIPC 252 >AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor protein. Length = 139 Score = 21.8 bits (44), Expect = 7.0 Identities = 8/17 (47%), Positives = 12/17 (70%), Gaps = 1/17 (5%) Frame = +1 Query: 445 FITQHIM-ALVRNCMHP 492 F T +++ A RNC+HP Sbjct: 25 FFTMYLVRAFCRNCIHP 41 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.8 bits (44), Expect = 7.0 Identities = 8/17 (47%), Positives = 12/17 (70%), Gaps = 1/17 (5%) Frame = +1 Query: 445 FITQHIM-ALVRNCMHP 492 F T +++ A RNC+HP Sbjct: 473 FFTMYLVRAFCRNCIHP 489 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,476 Number of Sequences: 438 Number of extensions: 3621 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23388480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -