BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10h22r (747 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q7RF31 Cluster: Putative uncharacterized protein PY0488... 33 5.6 >UniRef50_Q7RF31 Cluster: Putative uncharacterized protein PY04880; n=11; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein PY04880 - Plasmodium yoelii yoelii Length = 2294 Score = 33.5 bits (73), Expect = 5.6 Identities = 30/89 (33%), Positives = 39/89 (43%), Gaps = 2/89 (2%) Frame = +2 Query: 83 IYIIQTLTIRYIYRINILLEIFHIGIRSNSIXXXXXXXXXXXAQNNIF*CGESKAFENKK 262 IY I +L I +IY I IL+EIF+ G +N F C F+NKK Sbjct: 801 IYDIVSLKINFIYEIYILIEIFNNGKNDIFYNYHNSGLQIFNILSN-FLC--MHYFDNKK 857 Query: 263 ENKTHN--QVETK*YGMYKPCLFTDSWQY 343 + K N E K YK D+W+Y Sbjct: 858 KKKKINYFSEEIKTVNNYKQ---VDNWEY 883 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 614,392,474 Number of Sequences: 1657284 Number of extensions: 10743810 Number of successful extensions: 22452 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 21415 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22411 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 61323318355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -