BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10h22r (747 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pomb... 27 3.8 SPBC725.07 |pex5||peroxisomal targeting signal receptor |Schizos... 27 3.8 SPBC106.17c |cys2||O-acetyltransferase |Schizosaccharomyces pomb... 25 8.7 SPAC13G7.05 |||acyl-coA-sterol acyltransferase |Schizosaccharomy... 25 8.7 >SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 2685 Score = 26.6 bits (56), Expect = 3.8 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -2 Query: 305 FHIILFLLDYVFYFPF 258 FH++LF+L YV +PF Sbjct: 21 FHLVLFVLSYVLGWPF 36 >SPBC725.07 |pex5||peroxisomal targeting signal receptor |Schizosaccharomyces pombe|chr 2|||Manual Length = 598 Score = 26.6 bits (56), Expect = 3.8 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 703 RFLSTYQFYLRVTSSATSEDINLDYFSNKAK 611 R +S Y+RV S+ +INL YF + AK Sbjct: 497 RAVSLQPQYVRVRSNMAVSNINLGYFEDAAK 527 >SPBC106.17c |cys2||O-acetyltransferase |Schizosaccharomyces pombe|chr 2|||Manual Length = 504 Score = 25.4 bits (53), Expect = 8.7 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -3 Query: 502 KVKPGFEKYYVLSSFQCSSGCMYPNYTV 419 K+ GF+K+Y F C G + P + + Sbjct: 76 KIVSGFKKFYHNKPFLCDHGGILPKFEI 103 >SPAC13G7.05 |||acyl-coA-sterol acyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 537 Score = 25.4 bits (53), Expect = 8.7 Identities = 9/19 (47%), Positives = 16/19 (84%) Frame = +1 Query: 46 KYNFYLHVFLLTNLYHSNI 102 ++N +HVFL+ ++YHS+I Sbjct: 434 EWNKPVHVFLMRHVYHSSI 452 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,708,797 Number of Sequences: 5004 Number of extensions: 50109 Number of successful extensions: 104 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 103 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 104 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 355273338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -