BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10h20r (355 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC107860-1|AAI07861.1| 59|Homo sapiens LOC401397 protein protein. 39 0.004 >BC107860-1|AAI07861.1| 59|Homo sapiens LOC401397 protein protein. Length = 59 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/51 (39%), Positives = 33/51 (64%) Frame = -2 Query: 336 QLCFLLFTILGISNVEASTGYDFGDFLATVLGIGIAVVGILACLGNYARQR 184 QL +L ++L + V + + GD +A +LG+ +++ GI ACLG YAR+R Sbjct: 7 QLSLVLMSLLLVLPVVEAV--EAGDAIALLLGVVLSITGICACLGVYARKR 55 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 53,526,240 Number of Sequences: 237096 Number of extensions: 1115465 Number of successful extensions: 1964 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1936 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1964 length of database: 76,859,062 effective HSP length: 81 effective length of database: 57,654,286 effective search space used: 2075554296 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -