BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fner10h20r
(355 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
BC107860-1|AAI07861.1| 59|Homo sapiens LOC401397 protein protein. 39 0.004
>BC107860-1|AAI07861.1| 59|Homo sapiens LOC401397 protein protein.
Length = 59
Score = 39.1 bits (87), Expect = 0.004
Identities = 20/51 (39%), Positives = 33/51 (64%)
Frame = -2
Query: 336 QLCFLLFTILGISNVEASTGYDFGDFLATVLGIGIAVVGILACLGNYARQR 184
QL +L ++L + V + + GD +A +LG+ +++ GI ACLG YAR+R
Sbjct: 7 QLSLVLMSLLLVLPVVEAV--EAGDAIALLLGVVLSITGICACLGVYARKR 55
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 53,526,240
Number of Sequences: 237096
Number of extensions: 1115465
Number of successful extensions: 1964
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1936
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1964
length of database: 76,859,062
effective HSP length: 81
effective length of database: 57,654,286
effective search space used: 2075554296
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -