BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10h20r (355 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z70203-2|CAA94105.1| 685|Caenorhabditis elegans Hypothetical pr... 27 2.8 U55774-2|AAA98009.3| 380|Caenorhabditis elegans Hypothetical pr... 27 3.8 Z70036-1|CAA93875.1| 522|Caenorhabditis elegans Hypothetical pr... 27 5.0 U58757-12|AAK66021.1| 60|Caenorhabditis elegans Histone h1 lik... 27 5.0 U58757-11|AAC47916.1| 62|Caenorhabditis elegans Histone h1 lik... 27 5.0 U58757-10|AAK66020.1| 66|Caenorhabditis elegans Histone h1 lik... 27 5.0 AF216291-1|AAF23175.1| 60|Caenorhabditis elegans histone H1.Q ... 27 5.0 U53338-4|AAA96192.3| 235|Caenorhabditis elegans Hypothetical pr... 26 8.7 U40414-2|AAA81405.2| 634|Caenorhabditis elegans Hypothetical pr... 26 8.7 AF317421-1|AAK69599.1| 235|Caenorhabditis elegans lysosomal-ass... 26 8.7 >Z70203-2|CAA94105.1| 685|Caenorhabditis elegans Hypothetical protein C05G5.2 protein. Length = 685 Score = 27.5 bits (58), Expect = 2.8 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +2 Query: 215 KIPTTAIPIPKTVAKKSPKS*PVDASTLLIPRI 313 K P + +PK V +PK PV +T +IP++ Sbjct: 511 KKPIEPVVVPKAVDIPAPKPTPVTNTTAVIPKV 543 >U55774-2|AAA98009.3| 380|Caenorhabditis elegans Hypothetical protein F35G8.1 protein. Length = 380 Score = 27.1 bits (57), Expect = 3.8 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -2 Query: 273 DFGDFLATVLGIGIAVVGILACLGNYA 193 D G + T+L +G +VG L+ +GN A Sbjct: 18 DIGIHMKTLLAVGYGLVGALSLVGNLA 44 >Z70036-1|CAA93875.1| 522|Caenorhabditis elegans Hypothetical protein T01B4.1 protein. Length = 522 Score = 26.6 bits (56), Expect = 5.0 Identities = 14/44 (31%), Positives = 21/44 (47%), Gaps = 5/44 (11%) Frame = +1 Query: 73 RYMGWNEIFFSIFI-----YSRLACAETRWQVLMNLYKLVSRPL 189 R+ WN +FFS I Y LAC ++ +Y ++ PL Sbjct: 124 RWDFWNSVFFSATIFTTIGYGNLACKTNLGRIATIIYGMIGIPL 167 >U58757-12|AAK66021.1| 60|Caenorhabditis elegans Histone h1 like protein 7, isoformc protein. Length = 60 Score = 26.6 bits (56), Expect = 5.0 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +2 Query: 203 PKQAKIPTTAIPIPKTVAKKSP 268 PK+A P P+ K AKKSP Sbjct: 30 PKKAAAPKAKKPVKKAAAKKSP 51 >U58757-11|AAC47916.1| 62|Caenorhabditis elegans Histone h1 like protein 7, isoforma protein. Length = 62 Score = 26.6 bits (56), Expect = 5.0 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +2 Query: 203 PKQAKIPTTAIPIPKTVAKKSP 268 PK+A P P+ K AKKSP Sbjct: 32 PKKAAAPKAKKPVKKAAAKKSP 53 >U58757-10|AAK66020.1| 66|Caenorhabditis elegans Histone h1 like protein 7, isoformb protein. Length = 66 Score = 26.6 bits (56), Expect = 5.0 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +2 Query: 203 PKQAKIPTTAIPIPKTVAKKSP 268 PK+A P P+ K AKKSP Sbjct: 36 PKKAAAPKAKKPVKKAAAKKSP 57 >AF216291-1|AAF23175.1| 60|Caenorhabditis elegans histone H1.Q protein. Length = 60 Score = 26.6 bits (56), Expect = 5.0 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +2 Query: 203 PKQAKIPTTAIPIPKTVAKKSP 268 PK+A P P+ K AKKSP Sbjct: 30 PKKAAAPKAKKPVKKAAAKKSP 51 >U53338-4|AAA96192.3| 235|Caenorhabditis elegans Hypothetical protein C05E11.3 protein. Length = 235 Score = 25.8 bits (54), Expect = 8.7 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -2 Query: 276 YDFGDFLATVLGIGIAVVGILACLGNYARQRA 181 Y FG FLA ++G+G+ + + +R A Sbjct: 90 YVFGSFLAEMIGLGLGIFAVFLLFVALSRNSA 121 >U40414-2|AAA81405.2| 634|Caenorhabditis elegans Hypothetical protein F53B3.2 protein. Length = 634 Score = 25.8 bits (54), Expect = 8.7 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +2 Query: 224 TTAIPIPKTVAKKSPKS*PVD 286 TT+ P+PKT + PK PVD Sbjct: 93 TTSTPLPKTPKRFRPKIIPVD 113 >AF317421-1|AAK69599.1| 235|Caenorhabditis elegans lysosomal-associated transmembraneprotein protein. Length = 235 Score = 25.8 bits (54), Expect = 8.7 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -2 Query: 276 YDFGDFLATVLGIGIAVVGILACLGNYARQRA 181 Y FG FLA ++G+G+ + + +R A Sbjct: 90 YVFGSFLAEMIGLGLGIFAVFLLFVALSRNSA 121 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,637,581 Number of Sequences: 27780 Number of extensions: 174296 Number of successful extensions: 532 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 515 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 532 length of database: 12,740,198 effective HSP length: 73 effective length of database: 10,712,258 effective search space used: 471339352 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -