BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10h20r (355 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g26850.1 68418.m03203 expressed protein 27 4.7 At5g16070.1 68418.m01878 chaperonin, putative similar to SWISS-P... 26 6.3 At3g02530.1 68416.m00241 chaperonin, putative similar to SWISS-P... 26 6.3 >At5g26850.1 68418.m03203 expressed protein Length = 919 Score = 26.6 bits (56), Expect = 4.7 Identities = 15/55 (27%), Positives = 26/55 (47%) Frame = -2 Query: 171 FI*VHQNLPSCFSTRKSRINEYGKKYLIPSHIPVIYPRNFQAI*NKLKVLIYLFR 7 FI + LPS + +I + + I S +P I P N +AI + +++ R Sbjct: 602 FINLADMLPSMMKFTEDQIGQLLSAFWIQSALPDILPSNIEAIAHSFSLVLLSLR 656 >At5g16070.1 68418.m01878 chaperonin, putative similar to SWISS-PROT:P80317 T-complex protein 1, zeta subunit (TCP-1-zeta) [Mus musculus]; contains Pfam:PF00118 domain, TCP-1/cpn60 chaperonin family Length = 535 Score = 26.2 bits (55), Expect = 6.3 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -3 Query: 203 VITHGKGRETSLYRFIKTCHLVSAHASLE*MNMEKNISF 87 V+ HG R + R + CH+++ + SLE E N F Sbjct: 214 VLDHGS-RHPDMKRRAENCHILTCNVSLEYEKSEINAGF 251 >At3g02530.1 68416.m00241 chaperonin, putative similar to SWISS-PROT:P80317- T-complex protein 1, zeta subunit (TCP-1-zeta) [Mus musculus]; contains Pfam:PF00118 domain, TCP-1/cpn60 chaperonin family Length = 535 Score = 26.2 bits (55), Expect = 6.3 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -3 Query: 203 VITHGKGRETSLYRFIKTCHLVSAHASLE*MNMEKNISF 87 V+ HG R + R + CH+++ + SLE E N F Sbjct: 214 VLDHGS-RHPDMKRRAENCHILTCNVSLEYEKSEINAGF 251 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,097,781 Number of Sequences: 28952 Number of extensions: 161525 Number of successful extensions: 337 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 336 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 337 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 449370720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -