BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10h20f (409 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2561| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.6 SB_22837| Best HMM Match : REJ (HMM E-Value=0.057) 28 3.4 SB_53942| Best HMM Match : 7tm_1 (HMM E-Value=7.8e-08) 27 4.5 SB_48087| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.5 SB_38212| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.9 SB_49363| Best HMM Match : Laminin_G_2 (HMM E-Value=0.0048) 27 5.9 SB_6552| Best HMM Match : Glyco_transf_9 (HMM E-Value=1.9) 27 7.8 >SB_2561| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 28.3 bits (60), Expect = 2.6 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 70 IYRLRLW*LFGYCFRYRYSRCRNFSLFG*LRT 165 +YRL+ W + C Y Y R S+ G L+T Sbjct: 144 MYRLKAWNIMESCLSYIYPHTRLHSIIGILKT 175 >SB_22837| Best HMM Match : REJ (HMM E-Value=0.057) Length = 643 Score = 27.9 bits (59), Expect = 3.4 Identities = 23/77 (29%), Positives = 31/77 (40%) Frame = +2 Query: 56 SNVEASTGYDFGDFLATVLGIGIAVVGILACLGNYARQRARNEFI*VHQNLPSCFSTRKS 235 SN + S Y V+ IG + GI C+G R RAR V P+ ST S Sbjct: 538 SNCDWSILYVTVIIFGIVMAIGGIIWGICFCMGRSRRLRARKV---VAVEAPTIPSTSAS 594 Query: 236 RINEYGKKYLIPSHIPV 286 Y + + +PV Sbjct: 595 ESPGYDHSFFARASLPV 611 >SB_53942| Best HMM Match : 7tm_1 (HMM E-Value=7.8e-08) Length = 435 Score = 27.5 bits (58), Expect = 4.5 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +2 Query: 212 SCFSTRKSRINEYGKKYLIPSHIPVIYPRNFQAI*NKLKVL 334 SC + S N Y ++L+P+H P Y Q K++ L Sbjct: 108 SCTGSVSSEANLYDPRFLVPTHPPKAYGAEKQEATKKMENL 148 >SB_48087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1396 Score = 27.5 bits (58), Expect = 4.5 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +2 Query: 197 HQNLPSCFSTRKSRINEYGKKYLIPSHIPV 286 H N+PSC S + +N Y + P+ P+ Sbjct: 936 HNNVPSCQSATATPLNSYHSSLVNPTTTPI 965 >SB_38212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1892 Score = 27.1 bits (57), Expect = 5.9 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = -1 Query: 256 FSIFIYSRLACAETRWQVLMNLYKLVSRPLPCVI--TQTG*NSYNGYTDT*N 107 + +F+ SRLA RW L+ ++ + V+ T+T NS N + D N Sbjct: 61 YILFVLSRLAMIRLRWANLVISLMIIMPIIYLVVKETETDENSINNFEDDLN 112 >SB_49363| Best HMM Match : Laminin_G_2 (HMM E-Value=0.0048) Length = 355 Score = 27.1 bits (57), Expect = 5.9 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 Query: 40 HNSWYKQCGSIYRLRLW 90 H WY CG I LR+W Sbjct: 261 HCGWYPFCGQIRELRVW 277 >SB_6552| Best HMM Match : Glyco_transf_9 (HMM E-Value=1.9) Length = 930 Score = 26.6 bits (56), Expect = 7.8 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 Query: 212 SCFSTRKSRINEYGKKYLIPSHIPVIY 292 SC + S N Y ++L+P+H P Y Sbjct: 891 SCTGSVSSEANLYDPRFLVPTHPPKAY 917 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,368,004 Number of Sequences: 59808 Number of extensions: 252424 Number of successful extensions: 485 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 458 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 485 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 740151420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -