BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10h20f (409 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g16070.1 68418.m01878 chaperonin, putative similar to SWISS-P... 26 8.5 At3g02530.1 68416.m00241 chaperonin, putative similar to SWISS-P... 26 8.5 >At5g16070.1 68418.m01878 chaperonin, putative similar to SWISS-PROT:P80317 T-complex protein 1, zeta subunit (TCP-1-zeta) [Mus musculus]; contains Pfam:PF00118 domain, TCP-1/cpn60 chaperonin family Length = 535 Score = 26.2 bits (55), Expect = 8.5 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +3 Query: 153 VITHGKGRETSLYRFIKTCHLVSAHASLE*MNMEKNISF 269 V+ HG R + R + CH+++ + SLE E N F Sbjct: 214 VLDHGS-RHPDMKRRAENCHILTCNVSLEYEKSEINAGF 251 >At3g02530.1 68416.m00241 chaperonin, putative similar to SWISS-PROT:P80317- T-complex protein 1, zeta subunit (TCP-1-zeta) [Mus musculus]; contains Pfam:PF00118 domain, TCP-1/cpn60 chaperonin family Length = 535 Score = 26.2 bits (55), Expect = 8.5 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +3 Query: 153 VITHGKGRETSLYRFIKTCHLVSAHASLE*MNMEKNISF 269 V+ HG R + R + CH+++ + SLE E N F Sbjct: 214 VLDHGS-RHPDMKRRAENCHILTCNVSLEYEKSEINAGF 251 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,772,558 Number of Sequences: 28952 Number of extensions: 177601 Number of successful extensions: 345 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 344 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 345 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 605614832 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -