BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10h19r (437 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 26 0.51 AY255857-1|AAP13483.1| 216|Anopheles gambiae glutathione tranfe... 24 2.7 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 24 2.7 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 3.6 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 23 4.8 AJ007394-1|CAA07489.1| 112|Anopheles gambiae mucin protein. 23 4.8 AF046924-1|AAC08530.1| 122|Anopheles gambiae mucin protein. 23 4.8 AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein pr... 23 6.3 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 22 8.3 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 26.2 bits (55), Expect = 0.51 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +3 Query: 177 NLHERLYLGPLVDFILSHPLVHFPG 251 NLH G +V I +H VHFPG Sbjct: 498 NLHRCKLCGKVVTHIRNHYHVHFPG 522 >AY255857-1|AAP13483.1| 216|Anopheles gambiae glutathione tranferase d9 protein. Length = 216 Score = 23.8 bits (49), Expect = 2.7 Identities = 7/22 (31%), Positives = 13/22 (59%) Frame = -1 Query: 215 IHKRSKIKPFVKVVNYNHLMPT 150 +H++ + P K +N H +PT Sbjct: 33 VHRKDYVNPAFKKINPQHTVPT 54 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 23.8 bits (49), Expect = 2.7 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -1 Query: 77 LRFNTRVRFEERYKSGKNQVVL 12 L T VR +ERYK K+ VVL Sbjct: 514 LLVQTAVRTDERYKPLKDHVVL 535 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.4 bits (48), Expect = 3.6 Identities = 18/58 (31%), Positives = 26/58 (44%), Gaps = 2/58 (3%) Frame = +3 Query: 153 WHQVIIVYNLHERLYLGPLVDFILSHPLVHFPGVPVDTSDESMPVRLV--GGTFVVIL 320 W + +YN H RLY L F+ P + P + S PV L+ G F ++L Sbjct: 2635 WDEETNLYNFHARLYDPELGRFLQLDPKEQYAS-PYLYAGNS-PVSLIDPDGQFAILL 2690 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.0 bits (47), Expect = 4.8 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +1 Query: 259 SIPATKACPYGLSEVPSS*FLTTIALRPAYRPLKTSTTLPG 381 + P T PYGLS SS L P P TLPG Sbjct: 1115 AFPVTPRTPYGLSNGTSSPAL------PPKSPTSQRITLPG 1149 >AJ007394-1|CAA07489.1| 112|Anopheles gambiae mucin protein. Length = 112 Score = 23.0 bits (47), Expect = 4.8 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -2 Query: 313 TTKVPPTSRTGMLSSLVSTGTPGKCT 236 TT V PT+ T + + +T PG+ T Sbjct: 40 TTTVAPTTTTTVAPTTTTTVAPGQTT 65 >AF046924-1|AAC08530.1| 122|Anopheles gambiae mucin protein. Length = 122 Score = 23.0 bits (47), Expect = 4.8 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -2 Query: 313 TTKVPPTSRTGMLSSLVSTGTPGKCT 236 TT V PT+ T + + +T PG+ T Sbjct: 40 TTTVAPTTTTTVAPTTTTTVAPGQTT 65 >AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein protein. Length = 942 Score = 22.6 bits (46), Expect = 6.3 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -1 Query: 263 IDRYPRKVHKRMGKNKIHKRS 201 I+ Y VH R G+N I RS Sbjct: 122 IEEYVTMVHNRFGRNPIVIRS 142 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +3 Query: 153 WHQVIIVYNLHERLYLGPLVDFILSHP 233 W + +YN H RLY L F+ P Sbjct: 2636 WDEETNLYNFHARLYDPELGRFLQLDP 2662 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 479,892 Number of Sequences: 2352 Number of extensions: 9112 Number of successful extensions: 19 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 36568146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -