BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10h19f (493 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g32220.1 68415.m03937 60S ribosomal protein L27 (RPL27A) 151 3e-37 At3g22230.1 68416.m02804 60S ribosomal protein L27 (RPL27B) simi... 150 4e-37 At4g15000.1 68417.m02304 60S ribosomal protein L27 (RPL27C) 148 2e-36 At1g18540.1 68414.m02313 60S ribosomal protein L6 (RPL6A) simila... 36 0.020 At1g74060.1 68414.m08578 60S ribosomal protein L6 (RPL6B) simila... 33 0.14 At1g74050.1 68414.m08576 60S ribosomal protein L6 (RPL6C) simila... 33 0.14 At5g63900.1 68418.m08023 PHD finger family protein contains Pfam... 30 0.74 At4g34630.1 68417.m04918 expressed protein 29 1.7 At1g72440.1 68414.m08377 CCAAT-box-binding transcription factor-... 29 1.7 At1g66070.1 68414.m07499 translation initiation factor-related s... 29 1.7 At5g12000.1 68418.m01403 protein kinase family protein contains ... 28 3.9 At5g52090.1 68418.m06466 tRNA-splicing endonuclease positive eff... 27 9.1 At5g37150.1 68418.m04460 tRNA-splicing endonuclease positive eff... 27 9.1 At3g23320.1 68416.m02941 hypothetical protein 27 9.1 >At2g32220.1 68415.m03937 60S ribosomal protein L27 (RPL27A) Length = 135 Score = 151 bits (365), Expect = 3e-37 Identities = 66/135 (48%), Positives = 93/135 (68%), Gaps = 1/135 (0%) Frame = +1 Query: 40 MGKIMKPGKVVLVLSGRYAGRKAIVVKNYDEGTSDKPYGHAFVAGIDRYPRKVHKRMGKN 219 M K MKPGK V++L GRY G+KA++VK++D+GT +K YGH VAG+ +YP KV ++ Sbjct: 1 MVKCMKPGKAVILLQGRYTGKKAVIVKSFDDGTVEKKYGHCLVAGLKKYPSKVIRKDSAK 60 Query: 220 KIHKRSKIKPFVKVVNYNHLMPTRYTVDFSFEK-FSAKDLKDPAKRKKLRFNTRVRFEER 396 K K+S++K F KV+NY H+MPTRYT+D + SA + K+ + +FEER Sbjct: 61 KTAKKSRVKCFFKVINYQHVMPTRYTLDLDLKNVVSADAISSKDKKVTALKEAKAKFEER 120 Query: 397 YKSGKNKWFFQKLRF 441 +K+GKN+WFF KLRF Sbjct: 121 FKTGKNRWFFTKLRF 135 >At3g22230.1 68416.m02804 60S ribosomal protein L27 (RPL27B) similar to 60S RIBOSOMAL PROTEIN L27 GB:P41101 from [Solanum tuberosum] Length = 135 Score = 150 bits (364), Expect = 4e-37 Identities = 65/135 (48%), Positives = 95/135 (70%), Gaps = 1/135 (0%) Frame = +1 Query: 40 MGKIMKPGKVVLVLSGRYAGRKAIVVKNYDEGTSDKPYGHAFVAGIDRYPRKVHKRMGKN 219 M K +K K V++L GRYAG+KA+++K++D+GTSD+ YGH VAG+ +YP KV ++ Sbjct: 1 MVKFLKQNKAVILLQGRYAGKKAVIIKSFDDGTSDRRYGHCLVAGLKKYPSKVIRKDSAK 60 Query: 220 KIHKRSKIKPFVKVVNYNHLMPTRYTVDFSFEKFSAKD-LKDPAKRKKLRFNTRVRFEER 396 K K+S++K F+K+VNY HLMPTRYT+D ++ + D LK K+ + + EER Sbjct: 61 KTAKKSRVKCFIKLVNYQHLMPTRYTLDVDLKEVATLDALKSKDKKVTALKEAKAKLEER 120 Query: 397 YKSGKNKWFFQKLRF 441 +K+GKN+WFF KLRF Sbjct: 121 FKTGKNRWFFTKLRF 135 >At4g15000.1 68417.m02304 60S ribosomal protein L27 (RPL27C) Length = 135 Score = 148 bits (359), Expect = 2e-36 Identities = 63/135 (46%), Positives = 94/135 (69%), Gaps = 1/135 (0%) Frame = +1 Query: 40 MGKIMKPGKVVLVLSGRYAGRKAIVVKNYDEGTSDKPYGHAFVAGIDRYPRKVHKRMGKN 219 M K +K K V++L GRYAG+KA+++K++D+G D+PYGH VAG+ +YP KV ++ Sbjct: 1 MVKFLKQNKAVILLQGRYAGKKAVIIKSFDDGNRDRPYGHCLVAGLKKYPSKVIRKDSAK 60 Query: 220 KIHKRSKIKPFVKVVNYNHLMPTRYTVDFSFEKFSAKD-LKDPAKRKKLRFNTRVRFEER 396 K K+S++K F+K+VNY HLMPTRYT+D ++ + D L+ K+ + + EER Sbjct: 61 KTAKKSRVKCFIKLVNYQHLMPTRYTLDVDLKEVATLDALQSKDKKVAALKEAKAKLEER 120 Query: 397 YKSGKNKWFFQKLRF 441 +K+GKN+WFF KLRF Sbjct: 121 FKTGKNRWFFTKLRF 135 >At1g18540.1 68414.m02313 60S ribosomal protein L6 (RPL6A) similar to 60S ribosomal protein L6 GI:7208784 from [Cicer arietinum] Length = 233 Score = 35.5 bits (78), Expect = 0.020 Identities = 13/42 (30%), Positives = 26/42 (61%) Frame = +1 Query: 10 VNE*REYPSKMGKIMKPGKVVLVLSGRYAGRKAIVVKNYDEG 135 VN + P+K+ + PG V+++L+GR+ G++ + +K G Sbjct: 75 VNRRKPKPTKLKASITPGTVLIILAGRFKGKRVVFLKQLSSG 116 >At1g74060.1 68414.m08578 60S ribosomal protein L6 (RPL6B) similar to 60S ribosomal protein L6 (YL 16 like) GB:CAB57309 from [Cyanophora paradoxa] Length = 233 Score = 32.7 bits (71), Expect = 0.14 Identities = 11/35 (31%), Positives = 23/35 (65%) Frame = +1 Query: 31 PSKMGKIMKPGKVVLVLSGRYAGRKAIVVKNYDEG 135 P+K+ + PG V+++L+GR+ G++ + +K G Sbjct: 82 PAKLRASITPGTVLIILAGRFKGKRVVFLKQLASG 116 >At1g74050.1 68414.m08576 60S ribosomal protein L6 (RPL6C) similar to 60S ribosomal protein L6 (YL 16 like) GB:CAB57309 from [Cyanophora paradoxa] Length = 233 Score = 32.7 bits (71), Expect = 0.14 Identities = 11/35 (31%), Positives = 23/35 (65%) Frame = +1 Query: 31 PSKMGKIMKPGKVVLVLSGRYAGRKAIVVKNYDEG 135 P+K+ + PG V+++L+GR+ G++ + +K G Sbjct: 82 PTKLRASITPGTVLIILAGRFKGKRVVFLKQLASG 116 >At5g63900.1 68418.m08023 PHD finger family protein contains Pfam domain, PF00628: PHD-finger Length = 557 Score = 30.3 bits (65), Expect = 0.74 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 367 FNTRVRFEERYKSGKNKWFF 426 +N R + E+RYKS K KWF+ Sbjct: 58 YNKRNKKEQRYKSPKGKWFY 77 >At4g34630.1 68417.m04918 expressed protein Length = 199 Score = 29.1 bits (62), Expect = 1.7 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = +1 Query: 127 DEGTSDKPYGHAFVAGIDRYPRKVHKRMGKNKIHKRSK 240 D+G D+ Y ++ + PR V K++G+ ++ K K Sbjct: 130 DDGEEDREYDDSYDLDEELVPRSVSKKVGRQRMRKLGK 167 >At1g72440.1 68414.m08377 CCAAT-box-binding transcription factor-related similar to CCAAT-box-binding transcription factor (CCAAT-binding factor) (CBF) (Swiss-Prot:Q03701) [Homo sapiens], GB:P53569 [Mus musculus] Length = 1056 Score = 29.1 bits (62), Expect = 1.7 Identities = 17/52 (32%), Positives = 22/52 (42%) Frame = +1 Query: 205 RMGKNKIHKRSKIKPFVKVVNYNHLMPTRYTVDFSFEKFSAKDLKDPAKRKK 360 R K K KR + PF + Y HL+ D K K +P K+KK Sbjct: 1000 RSKKKKKEKRKRKSPFASLEEYKHLIDQDEKED---SKTKRKATSEPTKKKK 1048 >At1g66070.1 68414.m07499 translation initiation factor-related similar to Eukaryotic translation initiation factor 3 subunit 1 (eIF-3 alpha) (eIF3 p35) (eIF3j) (Swiss-Prot:O75822) [Homo sapiens] Length = 226 Score = 29.1 bits (62), Expect = 1.7 Identities = 18/60 (30%), Positives = 29/60 (48%) Frame = +1 Query: 238 KIKPFVKVVNYNHLMPTRYTVDFSFEKFSAKDLKDPAKRKKLRFNTRVRFEERYKSGKNK 417 +IKP+ K +Y L+ T + S A D+KD A N +++ E+ +GK K Sbjct: 139 RIKPYEKSYHYIALLKT--IMRLSLTNMKAADVKDVASSITTIANEKLKAEKEAAAGKKK 196 >At5g12000.1 68418.m01403 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 703 Score = 27.9 bits (59), Expect = 3.9 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = +1 Query: 178 DRYPRKVHKRMGKNKIHKR-SKIKPFVKVVNYNHLMPTRYTVDFSFEKFSAKDLKDPAKR 354 DR PR +R G+N + +R S K V H +PT ++DF++E K ++ R Sbjct: 188 DRSPRS--QRNGRNTVPERYSHENKGFKPVREMHKIPTNGSLDFNYEFRQGKGQRNSTGR 245 >At5g52090.1 68418.m06466 tRNA-splicing endonuclease positive effector-related contains similarity to SEN1, a positive effector of tRNA-splicing endonuclease [Saccharomyces cerevisiae] gi|172574|gb|AAB63976 Length = 676 Score = 26.6 bits (56), Expect = 9.1 Identities = 16/60 (26%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +1 Query: 157 HAFVAGID-RYPRKVHKRMGKNKIHKRSKIKPFVKVVNYNHLMPTRYTVDFSFEKFSAKD 333 HA + G + + P VH M + RS + V + + HL+ +Y + S +F K+ Sbjct: 391 HAILIGDEFQLPAMVHNEMCEKAKFGRSLFERLVLLGHNKHLLDVQYRMHPSISRFPNKE 450 >At5g37150.1 68418.m04460 tRNA-splicing endonuclease positive effector-related contains similarity to SEN1, a positive effector of tRNA-splicing endonuclease [Saccharomyces cerevisiae] gi|172574|gb|AAB63976 Length = 839 Score = 26.6 bits (56), Expect = 9.1 Identities = 16/60 (26%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +1 Query: 157 HAFVAGID-RYPRKVHKRMGKNKIHKRSKIKPFVKVVNYNHLMPTRYTVDFSFEKFSAKD 333 HA + G + + P VH M + RS + V + + HL+ +Y + S +F K+ Sbjct: 554 HAILIGDEFQLPAMVHNEMCEKAKFGRSLFERLVLLGHNKHLLDVQYRMHPSISRFPNKE 613 >At3g23320.1 68416.m02941 hypothetical protein Length = 191 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 51 NEAG*SSAGLKWPVRGSQG 107 N AG +GL+W +R SQG Sbjct: 46 NHAGRQDSGLRWIIRNSQG 64 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,402,100 Number of Sequences: 28952 Number of extensions: 210170 Number of successful extensions: 632 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 620 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 629 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 858708096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -