BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10h17r (737 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY060410-1|AAL25449.1| 115|Drosophila melanogaster LD35341p pro... 45 9e-05 AE014134-1970|AAF53017.1| 874|Drosophila melanogaster CG6700-PA... 45 9e-05 >AY060410-1|AAL25449.1| 115|Drosophila melanogaster LD35341p protein. Length = 115 Score = 45.2 bits (102), Expect = 9e-05 Identities = 21/48 (43%), Positives = 31/48 (64%) Frame = -2 Query: 535 SYRQTVPVEFIARELAFESSSKALEFLNQFPLSYVGCNRTQIDCKTSA 392 SYR + V++I + LAF+SS K E+L+ F L Y + Q+DCK +A Sbjct: 65 SYRPNISVDYITKILAFDSSEKCKEWLDTFSLPY-AADGAQVDCKNAA 111 >AE014134-1970|AAF53017.1| 874|Drosophila melanogaster CG6700-PA protein. Length = 874 Score = 45.2 bits (102), Expect = 9e-05 Identities = 21/48 (43%), Positives = 31/48 (64%) Frame = -2 Query: 535 SYRQTVPVEFIARELAFESSSKALEFLNQFPLSYVGCNRTQIDCKTSA 392 SYR + V++I + LAF+SS K E+L+ F L Y + Q+DCK +A Sbjct: 824 SYRPNISVDYITKILAFDSSEKCKEWLDTFSLPY-AADGAQVDCKNAA 870 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,119,259 Number of Sequences: 53049 Number of extensions: 657771 Number of successful extensions: 1332 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1298 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1332 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3334818762 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -