BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10h17r (737 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY588474-1|AAT94401.1| 104|Apis mellifera defensin 2 protein. 23 4.0 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 23 4.0 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 22 5.2 >AY588474-1|AAT94401.1| 104|Apis mellifera defensin 2 protein. Length = 104 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/36 (25%), Positives = 14/36 (38%) Frame = +2 Query: 128 IILWFKNWTSSKFHSCILMSQASSHVVVTCVFGTCI 235 ++ W W S +C + A +C G CI Sbjct: 66 VLSWQSKWLSINHSACAIRCLAQRRKGGSCRNGVCI 101 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 78 YYIYKEYIKPLKCVRGP*FYGLKT 149 ++ Y+E + P C GP Y LK+ Sbjct: 395 WFTYQETVDPAGCNAGPAKYYLKS 418 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 22.2 bits (45), Expect = 5.2 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 578 SLAGYVLIIPF*YVQLQTDRSCGIH 504 S+ GY I P L+ +CG+H Sbjct: 308 SVLGYKYITPLIQKHLKIHDTCGVH 332 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 199,674 Number of Sequences: 438 Number of extensions: 4473 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -