BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10h15f (350 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC550.14 |||vigilin |Schizosaccharomyces pombe|chr 3|||Manual 28 0.37 SPCC965.12 |||dipeptidyl aminopeptidase |Schizosaccharomyces pom... 27 1.1 SPAC29A4.02c |||translation elongation factor EF-1 gamma subunit... 24 6.0 SPBP23A10.04 |apc2||anaphase-promoting complex subunit Apc2 |Sch... 24 7.9 SPACUNK4.07c |cta4|sev4, SPAPYUK71.01|P-type ATPase, calcium tra... 24 7.9 >SPCC550.14 |||vigilin |Schizosaccharomyces pombe|chr 3|||Manual Length = 1279 Score = 28.3 bits (60), Expect = 0.37 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = -3 Query: 159 TQGSSVQWAFSGHPYSVVLASRAITATIRNTIKYCLA 49 T SS +WA GH +V A ++ +I+ ++ C+A Sbjct: 1174 TGSSSSEWAVRGHKENVEKAIASLEKSIKQVMENCIA 1210 >SPCC965.12 |||dipeptidyl aminopeptidase |Schizosaccharomyces pombe|chr 3|||Manual Length = 416 Score = 26.6 bits (56), Expect = 1.1 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +1 Query: 232 RRLSLQRGQKMCAHF*LLKCHNDL*SFFVILLNVQIEKK 348 + L+ QR +++C H ++ HND F LL VQ+ K Sbjct: 9 KELAQQRFKEICKHAKIVDTHND----FPYLLRVQLRNK 43 >SPAC29A4.02c |||translation elongation factor EF-1 gamma subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 409 Score = 24.2 bits (50), Expect = 6.0 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -2 Query: 145 SPMGIFRASIFGSAGLESHHGDNQEHD 65 SP +F S+ AG+E H D Q H+ Sbjct: 12 SPRVLFCVSVAAVAGVEVEHVDVQPHN 38 >SPBP23A10.04 |apc2||anaphase-promoting complex subunit Apc2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 681 Score = 23.8 bits (49), Expect = 7.9 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = +2 Query: 128 ENAHWTDDPCVRTCDDPYLTNTACVGALIQTCHCNDGLV 244 +N HW DP D T+ VG+LI + LV Sbjct: 352 DNYHWMPDPIDAAPDFKKPTDRDVVGSLISIFKSKEPLV 390 >SPACUNK4.07c |cta4|sev4, SPAPYUK71.01|P-type ATPase, calcium transporting Cta4 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1211 Score = 23.8 bits (49), Expect = 7.9 Identities = 14/47 (29%), Positives = 20/47 (42%) Frame = -2 Query: 328 LIKSRKKIINRYDILTIRNGHTFSVRVED*AVVTVAGLNEGADASGV 188 L + R I Y+I RN H F + ED V + + SG+ Sbjct: 243 LTEFRTMSIKPYEIQVYRNKHWFPISTEDLLPNDVVSVLHNKEDSGL 289 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,279,146 Number of Sequences: 5004 Number of extensions: 21615 Number of successful extensions: 61 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 2,362,478 effective HSP length: 64 effective length of database: 2,042,222 effective search space used: 106195544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -