BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10h14r (753 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5ZD47 Cluster: Putative uncharacterized protein P0445D... 34 4.3 UniRef50_Q559G0 Cluster: Putative uncharacterized protein; n=4; ... 33 10.0 >UniRef50_Q5ZD47 Cluster: Putative uncharacterized protein P0445D12.8; n=1; Oryza sativa (japonica cultivar-group)|Rep: Putative uncharacterized protein P0445D12.8 - Oryza sativa subsp. japonica (Rice) Length = 317 Score = 33.9 bits (74), Expect = 4.3 Identities = 18/57 (31%), Positives = 27/57 (47%) Frame = -2 Query: 245 LEFHKNISVPCVLFLVCFCRFGYFV*RMIFSVLLFDKCEGTKSVLV*WFSQIRIRTF 75 L + +P ++ V FC + V +I V++ D C KS V WF R RT+ Sbjct: 90 LSLSLHFKIPLLISFVSFCFSSHVVECLIAFVVILDFCVWIKSSFVVWFCSARRRTW 146 >UniRef50_Q559G0 Cluster: Putative uncharacterized protein; n=4; Dictyostelium discoideum|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 1212 Score = 32.7 bits (71), Expect = 10.0 Identities = 17/51 (33%), Positives = 29/51 (56%) Frame = +2 Query: 131 HIYQTIIPKKSCVKQSNQIYKNKLKTIHKEQKYFYGILKNKILCD*IDGGM 283 +I Q + +K K ++ IY+ +K I K ++ F+ + KNKIL I G + Sbjct: 70 NIKQELTKEKLINKFNSSIYQLPIKDIEKHEQLFWRVFKNKILFKTIFGNL 120 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 619,446,267 Number of Sequences: 1657284 Number of extensions: 11324054 Number of successful extensions: 23373 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22524 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23372 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 62146450145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -