BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10h14r (753 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 24 1.1 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 24 1.1 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 22 4.6 EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 22 6.0 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 22 6.0 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 24.2 bits (50), Expect = 1.1 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +2 Query: 488 N*NLCAECEIYFTNSVAVTLLVIGNALKETFRGVKK 595 N N +C YF V + LL++G LK F + K Sbjct: 48 NYNFTKKC--YFLRMVLIDLLIVGCILKHIFNILMK 81 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 24.2 bits (50), Expect = 1.1 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -2 Query: 473 SKLDVHQRYLVIKNNILATLFWHRQYCRYSELSCL 369 SKLDV Q L+ N++ H+Q + ELS + Sbjct: 296 SKLDVEQMNLLHSNDLNMHQQHHQQNMSHEELSAM 330 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 22.2 bits (45), Expect = 4.6 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -2 Query: 287 GTFHHLSSHIRFCFL 243 G HHL+ H CFL Sbjct: 364 GWIHHLARHAVACFL 378 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/25 (28%), Positives = 13/25 (52%) Frame = +2 Query: 386 YTYNIAYAKTMWLIYCFLSQGNVGV 460 Y + +W+++ + GNVGV Sbjct: 21 YFFETEQFTLLWVLFVIIVAGNVGV 45 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.8 bits (44), Expect = 6.0 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +3 Query: 288 LVFLLCIK*SYCCYCVSID*CVLNF*R 368 L+FLLCI YC + + C+ F R Sbjct: 279 LLFLLCIYYFYCALIILL--CIYYFCR 303 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +3 Query: 288 LVFLLCIK*SYCCYCV 335 L FLLCI YC + + Sbjct: 140 LFFLLCIYYFYCAFII 155 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,055 Number of Sequences: 336 Number of extensions: 3428 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20131186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -