BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10h14r (753 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_01_0102 + 1582793-1582898,1582988-1583093,1584115-1584172,158... 30 2.3 >09_01_0102 + 1582793-1582898,1582988-1583093,1584115-1584172, 1584676-1584745,1585132-1585197,1586374-1586429, 1587992-1588078,1588819-1589139,1589827-1589946, 1590747-1590881,1591529-1591605,1591681-1591756, 1592800-1592874,1592971-1593075,1593299-1593374, 1594482-1594617,1594702-1594804,1595186-1595298, 1596907-1597111,1597173-1597301,1597403-1597517, 1597710-1597795,1599108-1599203,1599615-1599751, 1600374-1600476,1601809-1601888,1602013-1602091, 1602241-1602298,1602489-1602586,1602673-1602767, 1602861-1602918 Length = 1074 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/44 (29%), Positives = 27/44 (61%) Frame = +2 Query: 134 IYQTIIPKKSCVKQSNQIYKNKLKTIHKEQKYFYGILKNKILCD 265 +Y+ + P K+ ++ K+KL+T + + Y+ GI++ K+L D Sbjct: 781 VYREVGPSNVLEKEIERV-KDKLQTAEQGKAYYEGIMETKVLPD 823 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,508,460 Number of Sequences: 37544 Number of extensions: 269539 Number of successful extensions: 443 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 434 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 443 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2004270760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -