BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10h14f (618 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 1.8 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 1.8 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 23 2.4 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 23 3.2 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 23 3.2 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 23 3.2 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 23 3.2 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 23 3.2 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 23 3.2 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 23 3.2 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 23 3.2 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 23 3.2 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 23 3.2 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 23 3.2 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 21 7.3 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 21 7.3 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 21 7.3 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 23.4 bits (48), Expect = 1.8 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = +1 Query: 88 RALLGYSPATAWTRCW 135 R ++GY P W CW Sbjct: 480 RDMIGYYPCCWWKICW 495 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 23.4 bits (48), Expect = 1.8 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = +1 Query: 88 RALLGYSPATAWTRCW 135 R ++GY P W CW Sbjct: 533 RDMIGYYPCCWWKICW 548 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 23.0 bits (47), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 568 PSHVQMYSPLLGRNTQTTSPRLSCRCSCIVR 476 P ++ P+L +T TTSP S + S IVR Sbjct: 313 PMLQKLEKPVLSSSTTTTSPMTSTK-STIVR 342 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -2 Query: 464 RFRRNLSKGPRSISNNN 414 R R SK P+ ISNNN Sbjct: 70 RTERERSKEPKIISNNN 86 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -2 Query: 464 RFRRNLSKGPRSISNNN 414 R R SK P+ ISNNN Sbjct: 70 RTERERSKEPKIISNNN 86 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -2 Query: 464 RFRRNLSKGPRSISNNN 414 R R SK P+ ISNNN Sbjct: 70 RTERERSKEPKIISNNN 86 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -2 Query: 464 RFRRNLSKGPRSISNNN 414 R R SK P+ ISNNN Sbjct: 70 RTERERSKEPKIISNNN 86 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -2 Query: 464 RFRRNLSKGPRSISNNN 414 R R SK P+ ISNNN Sbjct: 70 RTERERSKEPKIISNNN 86 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -2 Query: 464 RFRRNLSKGPRSISNNN 414 R R SK P+ ISNNN Sbjct: 70 RTERERSKEPKIISNNN 86 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -2 Query: 464 RFRRNLSKGPRSISNNN 414 R R SK P+ ISNNN Sbjct: 70 RTERERSKEPKIISNNN 86 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -2 Query: 464 RFRRNLSKGPRSISNNN 414 R R SK P+ ISNNN Sbjct: 70 RTERERSKEPKIISNNN 86 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -2 Query: 464 RFRRNLSKGPRSISNNN 414 R R SK P+ ISNNN Sbjct: 70 RTERERSKEPKIISNNN 86 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -2 Query: 464 RFRRNLSKGPRSISNNN 414 R R SK P+ ISNNN Sbjct: 303 RTERERSKEPKIISNNN 319 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -2 Query: 464 RFRRNLSKGPRSISNNN 414 R R SK P+ ISNNN Sbjct: 303 RTERERSKEPKIISNNN 319 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 21.4 bits (43), Expect = 7.3 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +3 Query: 294 KFLWRYANGMVRSK 335 KFLW Y GM S+ Sbjct: 80 KFLWWYKQGMFLSR 93 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 21.4 bits (43), Expect = 7.3 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +3 Query: 294 KFLWRYANGMVRSK 335 KFLW Y GM S+ Sbjct: 80 KFLWWYKQGMFLSR 93 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.4 bits (43), Expect = 7.3 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 258 LYIIFVTLPRDLKF 299 LY++F TLP L F Sbjct: 140 LYLLFATLPLRLSF 153 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,381 Number of Sequences: 438 Number of extensions: 3388 Number of successful extensions: 19 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18337950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -