BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10h12r (742 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 24 1.5 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 23 2.6 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 89 SRVHQLSPAKVFEARLHETPRSH 157 +R H LS + +A LH P SH Sbjct: 332 NRCHPLSLSSDHQAMLHHNPMSH 354 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 23.0 bits (47), Expect = 2.6 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +2 Query: 245 CECFHPHNGHVLQPRPHALLMQLVVMLTAYKD 340 C C P + + + P + QL VM++ Y D Sbjct: 578 CGCGWPQHMLIPKGTPEGMKSQLFVMISNYDD 609 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,818 Number of Sequences: 336 Number of extensions: 3668 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19884055 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -