BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10h11r (757 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 23 3.5 AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 22 4.6 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 21 8.0 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 8.0 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 8.0 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 8.0 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 8.0 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 22.6 bits (46), Expect = 3.5 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -1 Query: 187 IAASHRRKRGFSGQNTSRQGNPYQNG 110 +AASH +++ Q PY+NG Sbjct: 51 LAASHLQQQQLKKQRLDNGDYPYENG 76 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 22.2 bits (45), Expect = 4.6 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +2 Query: 344 LLTPLALTTAFKASSLL*AFLSEI 415 LLT LA + K SSLL F + I Sbjct: 63 LLTDLATSILLKVSSLLIGFCASI 86 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.4 bits (43), Expect = 8.0 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = +1 Query: 19 GDMFGAALRICQMNVMSTRH*HDKKIPTVLL 111 G ++GA + MNV + H + P +L Sbjct: 10 GQLYGAQIPAMSMNVKAAEHPSLRGTPLAML 40 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.4 bits (43), Expect = 8.0 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +2 Query: 131 LTACILSAEPPLSSVARSNKVGGEFLE 211 LT CI L ++RSNK FL+ Sbjct: 200 LTNCICFVPGVLGLLSRSNKESQRFLK 226 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.4 bits (43), Expect = 8.0 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +2 Query: 131 LTACILSAEPPLSSVARSNKVGGEFLE 211 LT CI L ++RSNK FL+ Sbjct: 200 LTNCICFVPGVLGLLSRSNKESQRFLK 226 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.4 bits (43), Expect = 8.0 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +2 Query: 131 LTACILSAEPPLSSVARSNKVGGEFLE 211 LT CI L ++RSNK FL+ Sbjct: 200 LTNCICFVPGVLGLLSRSNKESQRFLK 226 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.4 bits (43), Expect = 8.0 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +2 Query: 131 LTACILSAEPPLSSVARSNKVGGEFLE 211 LT CI L ++RSNK FL+ Sbjct: 200 LTNCICFVPGVLGLLSRSNKESQRFLK 226 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,139 Number of Sequences: 336 Number of extensions: 4265 Number of successful extensions: 16 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20234955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -