BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10h11f (612 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 21 6.2 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 21 8.2 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 21.4 bits (43), Expect = 6.2 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +1 Query: 91 TIPLPWGKLTLVSW 132 T PWGK V+W Sbjct: 193 TFQEPWGKRAYVTW 206 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 21.0 bits (42), Expect = 8.2 Identities = 13/41 (31%), Positives = 16/41 (39%) Frame = +3 Query: 378 GRRTSHVLQRYQSGPNKKTDSPRRGSFVATFTNGADE*ILQ 500 G + +L RY S + PR VA F ILQ Sbjct: 23 GNVVADILSRYPSDGEASYEYPREQPIVAMFEVNNTPEILQ 63 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,484 Number of Sequences: 336 Number of extensions: 3744 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15561709 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -