BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10h10r (748 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. 25 1.9 AJ549085-1|CAD70159.1| 529|Anopheles gambiae thioredoxin-disulf... 25 2.5 AJ549084-1|CAD70158.1| 505|Anopheles gambiae thioredoxin-disulf... 25 2.5 AJ459821-1|CAD30858.1| 502|Anopheles gambiae thioredoxin reduct... 25 2.5 AY823259-1|AAX18444.1| 194|Anopheles gambiae pburs protein. 23 7.6 >AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. Length = 189 Score = 25.4 bits (53), Expect = 1.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 228 PVTIKVAPEGGSCSLPTLQQAEVTNK 305 P T APEG S + PT +A T + Sbjct: 116 PTTSTAAPEGTSVASPTTAEASTTTE 141 >AJ549085-1|CAD70159.1| 529|Anopheles gambiae thioredoxin-disulfide reductase protein. Length = 529 Score = 25.0 bits (52), Expect = 2.5 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = +2 Query: 494 KVKYVSGVGYFSSIYIII 547 KV+YV+G+GYF + ++ Sbjct: 151 KVEYVNGLGYFKDDHTVV 168 >AJ549084-1|CAD70158.1| 505|Anopheles gambiae thioredoxin-disulfide reductase protein. Length = 505 Score = 25.0 bits (52), Expect = 2.5 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = +2 Query: 494 KVKYVSGVGYFSSIYIII 547 KV+YV+G+GYF + ++ Sbjct: 127 KVEYVNGLGYFKDDHTVV 144 >AJ459821-1|CAD30858.1| 502|Anopheles gambiae thioredoxin reductase protein. Length = 502 Score = 25.0 bits (52), Expect = 2.5 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = +2 Query: 494 KVKYVSGVGYFSSIYIII 547 KV+YV+G+GYF + ++ Sbjct: 124 KVEYVNGLGYFKDDHTVV 141 >AY823259-1|AAX18444.1| 194|Anopheles gambiae pburs protein. Length = 194 Score = 23.4 bits (48), Expect = 7.6 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = -2 Query: 522 YPTPETYLTLNSAVYKAFRTVQPSTPTATFGWPCLEAHACSRSILK 385 Y T +T+N K VQPS TAT G+ E + C S L+ Sbjct: 106 YRTCNGDVTVNKCEGKCNSQVQPSVITAT-GF-LKECYCCRESFLR 149 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 821,735 Number of Sequences: 2352 Number of extensions: 17643 Number of successful extensions: 41 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76923555 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -